KEGG   Trichechus manatus latirostris (Florida manatee): 101343482Help
Entry
101343482         CDS       T05135                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9 isoform X1
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343482
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101343482
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: TKL group
  MLK family
   101343482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr SH3_9 SH3_1 SH3_2 Pkinase_fungal OmpH
Motif
Other DBs
NCBI-GeneID: 101343482
NCBI-ProteinID: XP_004371056
UniProt: A0A2Y9DBN4
LinkDB All DBs
Position
Unknown
AA seq 1116 aa AA seqDB search
MEPPRALLGCLASAAAAAPPGEDGAGTGAEEEEEEEEEAAAAPVELGSDAPLPYWTAVFE
YEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQ
PGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDIS
QTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDIL
VNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWH
RTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVA
MNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFHCL
QDDWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILER
ELNIIIHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSL
INNRSSPPASPTIIPRLRAIQLTPGENSKTWGRSSVIPKEEGEEEEKRAPKKKGRTWGPS
TLGQKELASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLGKGPRS
SPALPGFTSLMEMVLLTAAWTIPFIFTEDEDSEGPRSGESRLQHSPNQSYLCIPFPRGED
GDGPCSDGVHEEPTPVNSATSTPQLTPTNSLKRGGTHHRRCEVALLGCGAVLAATGLGFD
LLEAGKCQLLPPEEPEPPAREEKKRREGLFQRANRPRRSTSPPSRKLFKKEEPMLLLGDP
SASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPISPVEAPPLTPCTHNPLVNVRVERF
KRDPNQSLTPTHVTLTAPTQPNSHRRTPSDGALKPVALVASRSPSSNGLSPSPGAGMLKT
PSPSRDPGEVPRLPDPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWW
FVSPSHARSASPANSSSTETPSNVDSCFASSSSTVEERPELPALLPFQAGSLPPVERTLL
DLDAEGQSQDSTVPLCRAELNTHRPAPYEIQQEFWS
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggagccccccagagcgcttctcggctgcctggcgagcgccgccgctgccgcgccgccg
ggggaggatggagcggggaccggggccgaggaggaagaggaagaggaggaggaggcggcg
gcggcccccgtggagctgggctccgatgcgcctctgccctattggacggccgtgttcgag
tacgaggcggccggcgaggacgagctgaccctgcgactgggcgacgtggtggaggtgctg
tccaaagactcgcaggtgtccggcgacgagggctggtggaccgggcaactgaaccagcgg
gtgggcatcttccccagcaactacgtgaccccgcgcagcgccttctccagccgctgccag
cccggcggcgaggaccccagttgctacccgcccattcaattgttagagattgattttgca
gagttaaccctggaagagatcatcggcatcgggggctttgggaaagtctatcgtgctttc
tggataggcgatgaggttgccgtaaaagcagctcgccatgaccctgatgaggacatcagc
cagaccatagagaatgtacgccaggaggccaagctctttgccatgctgaagcaccccaac
atcattgcccttaggggagtgtgtctgaaggaacccaacctctgcttggtcatggagttt
gctcgcggagggcctctgaatagagtgctatcagggaaaaggattcccccagacatcttg
gtgaactgggctgtgcagattgccagagggatgaactacttacatgatgaagcaatcgtc
cccatcatccaccgcgaccttaagtccagcaacatattgatcctccagaaggtggagaat
ggagacctaagcaacaagattctgaagatcactgactttggcctggctcgggaatggcac
cgaaccaccaagatgagtgcagcagggacatatgcttggatggcacccgaggtgattcgt
gcctcgatgttttccaaaggcagtgatgtgtggagctatggggtgctgctttgggagctg
ctgactggtgaagtgcccttccgaggaattgatggcttagcagtagcttatggagtcgcc
atgaacaaactcgcccttcccatcccttctacatgcccagaaccttttgccaaactcatg
gaagactgctggaatcctgacccccattcacgaccatctttcacaaatatcctggaccag
ctaactaccatagaggagtctggcttctttgaaatgcccaaggactccttccactgcctg
caggatgactggaaacatgagattcaggagatgtttgaccaactcagggctaaagaaaag
gagctccgcacctgggaggaggagctgacacgggcagcgttgcagcagaagaaccaggag
gagctgttgcggcgccgggagcaggaactggccgagcgggagattgacattctggaacgg
gagctcaacatcatcatccaccagctgtgccaggagaagccccgggtgaagaaacgcaag
ggcaagttcaggaagagccgactgaagctcaaggacggcaaccgcatcagcctcccttcc
gatttccagcacaagttcacagtgcaggcctccccaaccatggataaaaggaagagtctg
atcaacaaccgttccagtcctcctgcaagccccaccatcattcctcgcctccgagccatc
cagttgacaccaggtgaaaacagcaaaacctggggccggagctcagtcatcccgaaggag
gaaggcgaggaggaggagaagagggccccaaagaagaagggacggacgtgggggccaagt
acacttggtcagaaggaacttgcctcaggagatgaaggatcccctcagagacgtgagaaa
gctaatggtttaagtaccccatcagaatctccacatttccacttgggcctcaagtccttg
gtagatggatacaaacagtggtcatccagtgcccccaacctggggaagggcccgaggagc
agccctgccctgccagggttcaccagccttatggaaatggttcttcttactgctgcctgg
accattcctttcatcttcacagaggatgaggacagcgaaggcccaaggagtggggagagt
cgtctacagcattcacccaaccagtcctacctctgtatcccattccctcgtggagaggat
ggggatggcccctgcagtgatggagtccatgaggagcccaccccagtcaactcagccacc
agtacccctcagctgacgccaaccaatagcctcaagcggggtggtacccaccaccgccgc
tgtgaggtggctcttcttggctgtggggctgttcttgcagccacaggcctagggtttgat
ctgctggaagctggcaagtgccagctgcttcccccggaagagcctgagccaccagcccgg
gaggagaagaagaggcgtgagggtctttttcagagggccaaccgtcctcgtcggagcacc
agccccccctcccgaaagctcttcaagaaggaggaacccatgctgttgctaggtgacccc
tctgcctccctaacgctgctctctctctcctccatctctgagtgcaactccactcgctcc
ctgctgcgctctgacagcgatgagatcgtggtgtacgagatgcctatcagcccggttgag
gccccacctctgaccccctgcacccacaatcccctggtcaatgtccgagtggagcgattc
aagcgagaccccaaccaatccttgactcccacccacgtcacccttacggcccccacacag
ccaaatagtcaccgacggactccttctgacggggcccttaagccagtggctcttgtagcc
agcagaagcccctccagcaatgggttgagccccagtcctggagcaggaatgctgaaaacc
cccagtcctagccgagacccaggtgaagtcccccgtctccctgaccccaatgtggtcttt
cccccaaccccaaggcgctggaacacacaacaagactctaccttggagagacccaagacc
ctggagtttctgcctcggccacgtccttctgccaaccggcaacggctggacccttggtgg
tttgtgtcccccagccatgcccgcagcgcctccccagccaacagctccagcacggagacg
cccagcaacgtggattcctgctttgctagcagtagtagcactgtggaggagcggcctgaa
ctcccagccctgcttccattccaggcggggtcactaccccctgttgagcggacgcttctg
gacctggacgccgaggggcagagtcaggacagcactgtgccgctgtgcagagccgaactg
aacacacacaggcccgccccttatgagatccagcaagaattctggtcatag

DBGET integrated database retrieval system