KEGG   Trichechus manatus latirostris (Florida manatee): 101343529
Entry
101343529         CDS       T05135                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101343529
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:tmu04054]
    101343529
Membrane trafficking [BR:tmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101343529
Pattern recognition receptors [BR:tmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101343529
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_25 LRR_4
Other DBs
NCBI-GeneID: 101343529
NCBI-ProteinID: XP_004381972
UniProt: A0A2Y9DWN7
LinkDB
Position
Unknown
AA seq 987 aa
MASSFFSDFGLMWYLDELKKEEFRRFKELLRQEPLQLGLERIPWAEVKRATREDLANLLI
KHYQEQQAWDVTYRIFHKIGRKDLHIKAKRESTGYIRMYQAHVKKKFSNIWSRESLTRIH
DYFEQEVVIQKKRERMELLFEPKATGEEPSRTVVLVGTPKIGKTTFLVKLMLAWAEGIFY
QDRFLYIFYFCCWEVKRLALTSLAELISGDWPNPPVPIAEILSQPERLLFIIDSFEELTC
ALKEPESDLCSDWLQQQPGEVVLGSLLRKKMLPEASLLIATTPNYQQELEAQLEHPEIKT
IMGLNESDRKLYFSCVFQDKKQAMEAFSFVRENEQLFHMCQIPILCWVVCTCLKQEMERG
RDLALACHRTTSLFASFIFNMFTPKGATRPHEQIHVQLKGLCSLAVEGMWTDTFQFSEED
FRRNGLVESDIPALLDMKLLQKCRGYENSYTFIHVCIQEFCAAMFYLLKSSGNHPNPAVG
CSKALLLTYLKRENVHWILGGCFVFGLLNAEEEKRLDAFFDLQLSLEVKQQFHQCLKSLG
ECEHLEGEVDFLLFYCLFEMQDKVFVTKALDCFQEVHFSVTDNVDLMVSAYCLKHCSGLR
KISFSVRNVFKEENGDSSTSSYNLVRWHYICSVLTTNVHLRELQVHNSVLDESAFGALCK
ELRHPNCHLQKLEINNVSFSGESWLFFEVFIHNPYLKCLDLSSTRLYRNDVRLLCEALNY
PLCNIEDLTLANCLLSAGDCEAFASVLKSNKKLKYLNVAHNYLDQGVSLLCDALCHLDCV
LEALVLVYCYLSEPCWDSLCEVLVCNRSLIHLDLGGNVLKDDDLELLCAALKHPNCCLQS
LCLVKVSITDEGCRDIASVLTSNPNLRNLDIGNNDIQDEGVKLLCEALTHPNCHLENLGL
DSCQLTSACCEDLASALTQSKTLRRLSLTGNTLDHDGVVVLCEGLRHTECALRMLRLQKA
KFGEETQRLLMAEDERNPSLTIIIDNY
NT seq 2964 nt   +upstreamnt  +downstreamnt
atggcatcatctttcttctctgattttggccttatgtggtatctggacgagctcaaaaag
gaggagttcagaagatttaaggagctccttaggcaagagcctttgcaacttggactggag
cgaattccctgggctgaagtaaagagagcaactcgggaagatcttgcaaacctactgatc
aagcattatcaggaacagcaagcatgggatgtgacctacaggatctttcacaagattggt
agaaaggatctccatataaaggccaaaagggaaagtactgggtatataaggatgtatcaa
gctcatgtaaagaagaaattcagcaatatatggtcgagagaatccctcactaggattcat
gattactttgagcaggaagtagtcatacagaagaaacgtgaacgtatggaactccttttt
gagcctaaggcaactggagaagagccatcacgtactgtggtccttgtgggaaccccaaaa
attgggaagacgacgttcctggtcaagctaatgttggcctgggcagagggtatcttttat
caggataggttcttgtacattttctacttttgctgctgggaggtgaagcggttggcgctg
acaagcttggctgagttgatttctggagactggcccaacccccctgtgccaatagcagag
atcctgtcccagccagagagactgttgttcatcatcgacagctttgaggagctgacgtgt
gccttgaaagaaccggagtcagacctgtgcagtgactggttgcagcagcagccaggagaa
gtggtcctgggcagtttgctgaggaagaagatgctcccagaggcctcactgctcattgcc
actacacccaactaccagcaggaactcgaggctcagctggagcacccagaaattaaaacg
atcatgggacttaatgaaagcgacaggaagctgtacttctcctgtgtctttcaagacaag
aagcaagccatggaggccttcagttttgtaagagaaaatgaacagctctttcacatgtgc
caaatccccatcctttgctgggttgtgtgcacctgtctgaagcaggagatggagaggggc
agagacctggcacttgcctgccaccgtaccacttctctgtttgcctctttcatctttaac
atgttcacacccaagggtgccacacgtccacatgagcagatccatgtccagttgaagggt
ctgtgctccctggctgtggagggcatgtggacggacacattccagttcagtgaagaggac
ttcaggagaaatgggttagttgaaagtgatatccctgcattgctggacatgaagcttctt
cagaagtgcagggggtatgagaactcgtacacattcatccatgtgtgcatccaggagttc
tgtgccgccatgttttatttgctaaagagctccggcaatcaccccaatccagccgttgga
tgctcaaaggcgctgctattgacctacctaaagagagaaaacgtgcattggattttgggg
gggtgttttgtgtttggtcttttaaatgcagaggaagaaaaaaggctggatgctttcttt
gacttacaactgtccctggaggtaaagcagcaattccaccagtgcctgaagagtttaggt
gagtgtgaacatctggagggagaggtggatttcttgttattttactgtctgtttgagatg
caggataaagtctttgtgacgaaggcattggactgctttcaagaagttcacttctctgtc
actgacaatgtagacttgatggtttctgcctactgcctaaaacactgttctggcttgagg
aaaatttctttttccgtccgaaacgtcttcaaggaggagaatggagacagctctacgtca
agttacaatctcgtccgttggcattacatttgttctgtgctcaccacaaatgtacacctc
agagaactacaagtacacaacagtgtcctcgatgaatcagcctttggggctttgtgtaaa
gagctgaggcatccaaattgtcaccttcaaaagcttgagataaataatgtttccttctct
ggtgagagctggcttttctttgaggtgttcattcataacccatacttgaaatgcttggat
ctcagcagtacaagactctaccgtaatgatgtgaggttgctctgtgaggctttgaactat
ccactgtgcaacatagaagatctcacgctggcaaattgcctcctctcagcaggtgattgt
gaagccttcgcctcagttctaaaaagcaacaagaagctgaagtaccttaatgtagcacac
aattacctggaccaaggagtgagcctgctgtgtgatgctctgtgccacctagactgcgtg
ctggaggccttggtgttagtttactgttacctcagtgaaccatgctgggatagcctctgt
gaagttcttgtgtgtaacagaagcctgatccacctagatcttggtggtaatgtcctgaag
gatgatgacttggaactcctctgtgcggccttgaaacacccaaactgctgcctacagtcg
ctgtgtttggtaaaagtttccatcactgatgagggctgtcgagacattgcctcagtcctc
accagcaatccaaacctgagaaatctggatattgggaacaatgacatacaagatgagggt
gtgaagctgttgtgtgaagctctgacccatcccaactgtcacttagagaatcttggactg
gattcatgtcagctgactagtgcctgctgtgaggaccttgcctctgctcttacccaaagt
aaaactctgaggaggctaagcctgactggcaacaccttggaccacgacggggtggtggtg
ctgtgtgagggcttaagacacactgagtgcgccctgaggatgcttaggctgcaaaaagcc
aaatttggtgaggaaacccagagacttctgatggctgaggacgagagaaacccctctttg
acaatcatcatagataactactga

DBGET integrated database retrieval system