KEGG   Trichechus manatus latirostris (Florida manatee): 101343535
Entry
101343535         CDS       T05135                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04012  ErbB signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04350  TGF-beta signaling pathway
tmu04371  Apelin signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04714  Thermogenesis
tmu04910  Insulin signaling pathway
tmu04931  Insulin resistance
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101343535
   04350 TGF-beta signaling pathway
    101343535
   04371 Apelin signaling pathway
    101343535
   04066 HIF-1 signaling pathway
    101343535
   04151 PI3K-Akt signaling pathway
    101343535
   04152 AMPK signaling pathway
    101343535
   04150 mTOR signaling pathway
    101343535
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101343535
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101343535
  09152 Endocrine system
   04910 Insulin signaling pathway
    101343535
  09149 Aging
   04211 Longevity regulating pathway
    101343535
   04213 Longevity regulating pathway - multiple species
    101343535
  09159 Environmental adaptation
   04714 Thermogenesis
    101343535
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343535
   05205 Proteoglycans in cancer
    101343535
   05231 Choline metabolism in cancer
    101343535
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101343535
  09162 Cancer: specific types
   05210 Colorectal cancer
    101343535
   05212 Pancreatic cancer
    101343535
   05225 Hepatocellular carcinoma
    101343535
   05226 Gastric cancer
    101343535
   05221 Acute myeloid leukemia
    101343535
   05224 Breast cancer
    101343535
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101343535
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101343535
   05163 Human cytomegalovirus infection
    101343535
   05165 Human papillomavirus infection
    101343535
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101343535
   01522 Endocrine resistance
    101343535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343535
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101343535
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101343535
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101343535
NCBI-ProteinID: XP_004383713
UniProt: A0A2Y9DYE6
LinkDB
Position
Unknown
AA seq 482 aa
MAAVFDLDLETEEGSEGEGEPELSPADVCPLAELRSAGLEPVGHYEEVELTETSVNLGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIVKGKLVLPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDGADVQRHPFFRHINWDDLLARRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDSALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPSEPMEPILPPLLPPPPPSSTAPLPIRPPSGTKKSKRGRGRP
GR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcagccgtgttcgacctggacctggagacggaggagggcagcgagggcgagggcgag
ccagagctcagccctgcggacgtgtgtccccttgccgagttgaggtcggctggcctggag
cctgtgggacactatgaggaggtggagctgaccgagaccagtgtcaacctcggccccgag
cgcattgggccccactgctttgaactgctgcgtgtactgggcaaggggggctatggcaag
gtgttccaggtgcgaaaggtgcaaggtaccaacttgggcaaaatatatgccatgaaagtc
ctgaggaaggccaaaattgtgtgcaacgccaaggacacagcgcacacacgggcggagcgg
aacattctagagtctgtgaagcaccccttcattgtggaactggcctatgccttccagact
ggtggcaagctctacctcatcctggagtgcctcagtggcggcgagctcttcacgcatctg
gagcgagaaggcatcttcctggaggacacagcctgcttctacctggcagagatcactctg
gcccttggccacctgcactcccaaggcatcatctaccgggacctcaaacctgagaacatc
atgctcaacagccagggtcacatcaagctgacggactttgggctctgcaaggagtccatt
cacgagggtgccgtcacccacaccttctgcggcaccatcgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccaccctttaccgcagagaaccggaagaaaaccatggacaag
atcgtcaaggggaagctggtgctgcccccctacctcaccccggatgcccgggacctcgtc
aaaaagtttctgaagcggaatcccagccaacggattgggggtggcccaggggacggcgct
gatgtgcagaggcaccccttcttccggcacatcaactgggacgatctcctagcccgccgc
gtggatccccccttcaggccctgtctgcagtcggaggaggacgtgagccagtttgacacc
cgcttcacgcggcagacgccagtggacagtcccgacgactcggcccttagtgagagtgcc
aaccaggctttcctgggcttcacgtacgtggcaccctccgtcctggacagcattaaggag
ggcttctccttccagcccaagctgcgctcccccaggcgcctcaacagcagcccccggacc
cctatcagccccctgaagttctccccttttgaggggttccggcccagccctggcccatcg
gagcccatggagcccattctacctccactcctgccaccaccgccaccctcgagcactgcc
cctctccctatccgtcccccctcagggaccaagaagtccaagaggggccgtgggcgccct
gggcgctag

KEGG   Trichechus manatus latirostris (Florida manatee): 101354510
Entry
101354510         CDS       T05135                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04012  ErbB signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04350  TGF-beta signaling pathway
tmu04371  Apelin signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04714  Thermogenesis
tmu04910  Insulin signaling pathway
tmu04931  Insulin resistance
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101354510
   04350 TGF-beta signaling pathway
    101354510
   04371 Apelin signaling pathway
    101354510
   04066 HIF-1 signaling pathway
    101354510
   04151 PI3K-Akt signaling pathway
    101354510
   04152 AMPK signaling pathway
    101354510
   04150 mTOR signaling pathway
    101354510
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101354510
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101354510
  09152 Endocrine system
   04910 Insulin signaling pathway
    101354510
  09149 Aging
   04211 Longevity regulating pathway
    101354510
   04213 Longevity regulating pathway - multiple species
    101354510
  09159 Environmental adaptation
   04714 Thermogenesis
    101354510
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101354510
   05205 Proteoglycans in cancer
    101354510
   05231 Choline metabolism in cancer
    101354510
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101354510
  09162 Cancer: specific types
   05210 Colorectal cancer
    101354510
   05212 Pancreatic cancer
    101354510
   05225 Hepatocellular carcinoma
    101354510
   05226 Gastric cancer
    101354510
   05221 Acute myeloid leukemia
    101354510
   05224 Breast cancer
    101354510
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101354510
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101354510
   05163 Human cytomegalovirus infection
    101354510
   05165 Human papillomavirus infection
    101354510
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101354510
   01522 Endocrine resistance
    101354510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101354510
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101354510
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101354510
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101354510
NCBI-ProteinID: XP_004377906
UniProt: A0A2Y9DNR4
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYSAPDVRDRETEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASTSTVNPPTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttactcagcgccggacgtccgagacagggaa
actgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaacgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gcaatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaaacatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacacagcttgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacactttttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccataatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaagtgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctaaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggagaagttcaggctcatccattcttcagacacattaactgggaagaacta
ctggctcggaaagtggagcccccttttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtttttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccggtcaaattttctcctggggatttctggggaagaggt
gcttcaaccagcacagtaaatcctccaacacctgtggaatacccaatggaaacgagtgga
gtagagcagatggatgtgacaatgagtggggaagcatcagcaccacttccaatacgacag
ccaaactccgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system