KEGG   Trichechus manatus latirostris (Florida manatee): 101343784
Entry
101343784         CDS       T05135                                 

Definition
(RefSeq) serine/threonine-protein kinase pim-1 isoform X2
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04630  JAK-STAT signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101343784
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343784
   05206 MicroRNAs in cancer
    101343784
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101343784
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101343784
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101343784
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   101343784
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 101343784
NCBI-ProteinID: XP_004379474
UniProt: A0A2Y9DSI4
LinkDB
Position
Unknown
AA seq 313 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGVRVAD
NLPVAIKHVEKDRISDWGELPSGTRVPMEVVLLKKVSSGFSGVIRLLDWFERSDSFVLIL
ERPEPVQDLFDFITERGALPEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSPECQHLIKWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPEPNK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaaactggcgcctgggaaggagaaggagccgctggagtcgcagtatcaggtg
ggcccgctattgggcagcggcggcttcggctccgtctactcaggcgttcgtgtcgccgac
aacttgccggtggccatcaagcacgtggagaaggaccggatttccgactggggagagctg
cccagtggcacccgagtgcccatggaagtggtcctgctgaagaaggtgagctcgggcttt
tccggcgtcattagactcctggactggttcgagaggtccgacagtttcgtcctgatcctg
gaaaggcccgagccggtgcaagacctcttcgactttatcacggaaaggggggccctgccg
gaggagctggcccgcagcttcttctggcaggtgctggaggccgtgcggcactgccacaac
tgcggggtgctccaccgcgacatcaaggacgagaacatcctcatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacactgtctacacggac
ttcgacgggacccgagtgtatagtcctccagagtggatccgctaccatcgctaccacggc
aggtcggcggctgtctggtccctggggatcctgctatacgatatggtctgtggtgatatt
ccctttgagcacgatgaggagatcatcaggggccaggttttcttcaggcagagggtctct
ccagagtgtcagcatctcattaaatggtgcttggccctgaggccatcagatcggccaacc
ttcgaagaaatccagaaccacccatggatgcaagatgtcctcctgccccaggaaactgct
gagatccatctccacagcctgtcgccagagcccaacaaatag

DBGET integrated database retrieval system