KEGG   Trichechus manatus latirostris (Florida manatee): 101343804
Entry
101343804         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04670  Leukocyte transendothelial migration
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05020  Prion disease
tmu05100  Bacterial invasion of epithelial cells
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05146  Amoebiasis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101343804
   04014 Ras signaling pathway
    101343804
   04015 Rap1 signaling pathway
    101343804
   04370 VEGF signaling pathway
    101343804
   04630 JAK-STAT signaling pathway
    101343804
   04668 TNF signaling pathway
    101343804
   04066 HIF-1 signaling pathway
    101343804
   04068 FoxO signaling pathway
    101343804
   04070 Phosphatidylinositol signaling system
    101343804
   04072 Phospholipase D signaling pathway
    101343804
   04071 Sphingolipid signaling pathway
    101343804
   04024 cAMP signaling pathway
    101343804
   04151 PI3K-Akt signaling pathway
    101343804
   04152 AMPK signaling pathway
    101343804
   04150 mTOR signaling pathway
    101343804
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101343804
  09143 Cell growth and death
   04210 Apoptosis
    101343804
   04218 Cellular senescence
    101343804
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101343804
   04550 Signaling pathways regulating pluripotency of stem cells
    101343804
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101343804
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101343804
   04620 Toll-like receptor signaling pathway
    101343804
   04625 C-type lectin receptor signaling pathway
    101343804
   04650 Natural killer cell mediated cytotoxicity
    101343804
   04660 T cell receptor signaling pathway
    101343804
   04662 B cell receptor signaling pathway
    101343804
   04664 Fc epsilon RI signaling pathway
    101343804
   04666 Fc gamma R-mediated phagocytosis
    101343804
   04670 Leukocyte transendothelial migration
    101343804
   04062 Chemokine signaling pathway
    101343804
  09152 Endocrine system
   04910 Insulin signaling pathway
    101343804
   04923 Regulation of lipolysis in adipocytes
    101343804
   04929 GnRH secretion
    101343804
   04915 Estrogen signaling pathway
    101343804
   04914 Progesterone-mediated oocyte maturation
    101343804
   04917 Prolactin signaling pathway
    101343804
   04926 Relaxin signaling pathway
    101343804
   04935 Growth hormone synthesis, secretion and action
    101343804
   04919 Thyroid hormone signaling pathway
    101343804
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101343804
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101343804
  09156 Nervous system
   04725 Cholinergic synapse
    101343804
   04722 Neurotrophin signaling pathway
    101343804
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101343804
  09158 Development and regeneration
   04360 Axon guidance
    101343804
   04380 Osteoclast differentiation
    101343804
  09149 Aging
   04211 Longevity regulating pathway
    101343804
   04213 Longevity regulating pathway - multiple species
    101343804
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343804
   05206 MicroRNAs in cancer
    101343804
   05205 Proteoglycans in cancer
    101343804
   05203 Viral carcinogenesis
    101343804
   05230 Central carbon metabolism in cancer
    101343804
   05231 Choline metabolism in cancer
    101343804
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101343804
  09162 Cancer: specific types
   05210 Colorectal cancer
    101343804
   05212 Pancreatic cancer
    101343804
   05225 Hepatocellular carcinoma
    101343804
   05226 Gastric cancer
    101343804
   05214 Glioma
    101343804
   05221 Acute myeloid leukemia
    101343804
   05220 Chronic myeloid leukemia
    101343804
   05218 Melanoma
    101343804
   05211 Renal cell carcinoma
    101343804
   05215 Prostate cancer
    101343804
   05213 Endometrial cancer
    101343804
   05224 Breast cancer
    101343804
   05222 Small cell lung cancer
    101343804
   05223 Non-small cell lung cancer
    101343804
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101343804
   05017 Spinocerebellar ataxia
    101343804
   05020 Prion disease
    101343804
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101343804
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101343804
   04932 Non-alcoholic fatty liver disease
    101343804
   04931 Insulin resistance
    101343804
   04933 AGE-RAGE signaling pathway in diabetic complications
    101343804
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101343804
   05100 Bacterial invasion of epithelial cells
    101343804
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101343804
   05170 Human immunodeficiency virus 1 infection
    101343804
   05161 Hepatitis B
    101343804
   05160 Hepatitis C
    101343804
   05171 Coronavirus disease - COVID-19
    101343804
   05164 Influenza A
    101343804
   05162 Measles
    101343804
   05168 Herpes simplex virus 1 infection
    101343804
   05163 Human cytomegalovirus infection
    101343804
   05167 Kaposi sarcoma-associated herpesvirus infection
    101343804
   05169 Epstein-Barr virus infection
    101343804
   05165 Human papillomavirus infection
    101343804
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101343804
   05142 Chagas disease
    101343804
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101343804
   01524 Platinum drug resistance
    101343804
   01522 Endocrine resistance
    101343804
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101343804
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101343804
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 101343804
NCBI-ProteinID: XP_004384448
UniProt: A0A2Y9E166
LinkDB
Position
Unknown
AA seq 729 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQTVGWMPGV
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPREGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEATERTGLDSDSLYRPELPAPRTDWSLSDVEQWDAVALSDGIKGFLLA
LPAPLVTPEAAAEALRALREGSGPVGPVLEPPTLPLHRALTLRFLLQHLSRVVRRAPAPG
SAVRALAAAFGPLLLLRALPPSPPPGGAPDGTEPSPSPDFPAKLVEKLLQEYMEEQEVVP
PALPPKPPKAKPASGALANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASS
KIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDT
RLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRT
AIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESR
TKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKN
ETEDQYSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSV
VVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALAVTLAHPVRAP
GPGPPPAAR
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcaggcgccgaaggcttccagtaccgcgcgctgtacccattccgccgagagcggccc
gaggacctggagctgctgccaggggatgtgctggtggtgagccgggcggccctgcaggca
ctgggcgtggctgagggcggcgagcgctgcccacagaccgtgggctggatgccgggtgtc
aatgagcgcacgaggcagcgcggcgacttccccggcacctacgttgagttcctgggccct
gtggccctggcccggcccggcccccgcccacgtggcccccgcccactacctgcccggccc
cgagaggggccccccgagccaggcctcactctccctgacctgcctgagcaattctcccct
cctgatgtggcgcccccacttctggtgaagctcgtggaggccactgagcggacagggctg
gacagtgactccctctacaggccagagctgcctgccccgcgcacagactggtccctgagc
gatgtggagcagtgggatgcggtggctctgtcggacggcatcaagggcttcctgctggcg
ctgccggcgcccctcgtgacgcccgaggctgcggccgaggcgcttcgggccctacgggag
ggctcggggcccgtggggccggtgctggagccaccaacgttgccactgcaccgcgcgctc
acgctgcgcttcctgctccaacacctgagccgtgtggttcggcgcgccccagccccaggc
tccgcggtccgtgccctggccgccgccttcgggccgctgctgctcctgcgtgcgctgccg
ccttcgccgccaccagggggtgcaccagacgggactgagcccagccccagccccgacttc
cctgcaaagctggtggagaagttgctgcaggaatatatggaggagcaagaggtcgtgccc
ccagcactgccgcctaaacctcccaaggcaaagccggcctctggggccctggccaatggg
gggagcccgccctccctgcaggatgctgagtggtactggggggacatctccagggaagag
gtgaacgagaaactccgagacacgcctgatggtactttcctggtccgagatgcatcgagc
aagatccagggggagtacacgctgaccctcaggaaaggcggcaacaacaagctaatcaag
gtgttccaccgtgacggccactatggcttctcagaaccgctcaccttctgctcagtggtg
gacctcatcacccactaccgccatgagtcactggcccagtacaacgccaagctggacacg
cggctgctgtaccctgtgtccaagtaccagcaggaccagatcgtgaaggaggacagcgtg
gaggcagtgggtgcccagcttaaggtctaccaccagcagtaccaggacaagagccgcgag
tatgaccagctgtacgaagagtacacacgcacctctcaggagctgcagatgaagcgcacc
gcaatcgaggccttcaacgagaccatcaagatctttgaggagcagggccaaacacaagag
aaatgcagcaaggaatatctggagcgattccggcgtgagggcaacgagaaggagatgcag
aggatcctgctgaactcagagcggctcaagtcccgcatcgctgagatacatgagagccgc
acgaagctggagcaggagctgcgggcgcaggcctcggacaaccgggagatagataagcgc
atgaacagcctcaaacctgaccttatgcagcttcgcaagatccgagaccagtatcttgtg
tggctcacccaaaaaggtgcccggcaaaagaaaatcaacgagtggttagggatcaaaaat
gagaccgaagaccagtattccctgatggaggatgaggacgaccttccccaccatgaggaa
cggacgtggtatgtgggcaagatcaaccgcacccaggctgaggagatgctgagcggcaag
cgggacggcaccttcctcatccgcgagagcagccagcggggctgttatgcctgctctgta
gtggtggacggcgacaccaagcactgtgtcatctaccgcacagccaccggcttcggcttt
gcagagccctacaacctgtatgggtcgctgaaggagctggtgctgcactaccagcacgcc
tcactggtgcagcacaacgacgcgctcgccgtcacgctggcccaccctgtacgtgcgcca
gggcccgggcctccgcctgctgcccgctga

KEGG   Trichechus manatus latirostris (Florida manatee): 101346849
Entry
101346849         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00562  Inositol phosphate metabolism
tmu01100  Metabolic pathways
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04670  Leukocyte transendothelial migration
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05020  Prion disease
tmu05100  Bacterial invasion of epithelial cells
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05146  Amoebiasis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101346849
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101346849
   04014 Ras signaling pathway
    101346849
   04015 Rap1 signaling pathway
    101346849
   04370 VEGF signaling pathway
    101346849
   04630 JAK-STAT signaling pathway
    101346849
   04668 TNF signaling pathway
    101346849
   04066 HIF-1 signaling pathway
    101346849
   04068 FoxO signaling pathway
    101346849
   04070 Phosphatidylinositol signaling system
    101346849
   04072 Phospholipase D signaling pathway
    101346849
   04071 Sphingolipid signaling pathway
    101346849
   04024 cAMP signaling pathway
    101346849
   04151 PI3K-Akt signaling pathway
    101346849
   04152 AMPK signaling pathway
    101346849
   04150 mTOR signaling pathway
    101346849
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101346849
  09143 Cell growth and death
   04210 Apoptosis
    101346849
   04218 Cellular senescence
    101346849
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101346849
   04550 Signaling pathways regulating pluripotency of stem cells
    101346849
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101346849
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101346849
   04620 Toll-like receptor signaling pathway
    101346849
   04625 C-type lectin receptor signaling pathway
    101346849
   04650 Natural killer cell mediated cytotoxicity
    101346849
   04660 T cell receptor signaling pathway
    101346849
   04662 B cell receptor signaling pathway
    101346849
   04664 Fc epsilon RI signaling pathway
    101346849
   04666 Fc gamma R-mediated phagocytosis
    101346849
   04670 Leukocyte transendothelial migration
    101346849
   04062 Chemokine signaling pathway
    101346849
  09152 Endocrine system
   04910 Insulin signaling pathway
    101346849
   04923 Regulation of lipolysis in adipocytes
    101346849
   04929 GnRH secretion
    101346849
   04915 Estrogen signaling pathway
    101346849
   04914 Progesterone-mediated oocyte maturation
    101346849
   04917 Prolactin signaling pathway
    101346849
   04926 Relaxin signaling pathway
    101346849
   04935 Growth hormone synthesis, secretion and action
    101346849
   04919 Thyroid hormone signaling pathway
    101346849
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101346849
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101346849
  09156 Nervous system
   04725 Cholinergic synapse
    101346849
   04722 Neurotrophin signaling pathway
    101346849
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101346849
  09158 Development and regeneration
   04360 Axon guidance
    101346849
   04380 Osteoclast differentiation
    101346849
  09149 Aging
   04211 Longevity regulating pathway
    101346849
   04213 Longevity regulating pathway - multiple species
    101346849
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101346849
   05206 MicroRNAs in cancer
    101346849
   05205 Proteoglycans in cancer
    101346849
   05203 Viral carcinogenesis
    101346849
   05230 Central carbon metabolism in cancer
    101346849
   05231 Choline metabolism in cancer
    101346849
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101346849
  09162 Cancer: specific types
   05210 Colorectal cancer
    101346849
   05212 Pancreatic cancer
    101346849
   05225 Hepatocellular carcinoma
    101346849
   05226 Gastric cancer
    101346849
   05214 Glioma
    101346849
   05221 Acute myeloid leukemia
    101346849
   05220 Chronic myeloid leukemia
    101346849
   05218 Melanoma
    101346849
   05211 Renal cell carcinoma
    101346849
   05215 Prostate cancer
    101346849
   05213 Endometrial cancer
    101346849
   05224 Breast cancer
    101346849
   05222 Small cell lung cancer
    101346849
   05223 Non-small cell lung cancer
    101346849
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101346849
   05017 Spinocerebellar ataxia
    101346849
   05020 Prion disease
    101346849
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101346849
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101346849
   04932 Non-alcoholic fatty liver disease
    101346849
   04931 Insulin resistance
    101346849
   04933 AGE-RAGE signaling pathway in diabetic complications
    101346849
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101346849
   05135 Yersinia infection
    101346849
   05100 Bacterial invasion of epithelial cells
    101346849
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101346849
   05170 Human immunodeficiency virus 1 infection
    101346849
   05161 Hepatitis B
    101346849
   05160 Hepatitis C
    101346849
   05171 Coronavirus disease - COVID-19
    101346849
   05164 Influenza A
    101346849
   05162 Measles
    101346849
   05168 Herpes simplex virus 1 infection
    101346849
   05163 Human cytomegalovirus infection
    101346849
   05167 Kaposi sarcoma-associated herpesvirus infection
    101346849
   05169 Epstein-Barr virus infection
    101346849
   05165 Human papillomavirus infection
    101346849
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101346849
   05142 Chagas disease
    101346849
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101346849
   01524 Platinum drug resistance
    101346849
   01522 Endocrine resistance
    101346849
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101346849
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101346849
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101346849
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 101346849
NCBI-ProteinID: XP_004385147
UniProt: A0A2Y9E117
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKISHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFNYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggagaactgtggggcatccacttgatgcccccacgaatc
ttagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattagtaactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaggatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacgagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaatcgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaattcgacatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataagttagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgataagcagaagtatactctgaaaatcagccatgactgtgtgccagaacaggtg
attgccgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgagcaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtttgtggatgtgatgaatat
ttcctcgaaaagtatcctctgagtcagtataagtacataagaagctgtataatgcttgga
aggatgcccaatttgatgctgatggctaaagaaagtctctactctcaattgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttatcaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagatattgacaagatctatgttcgaacaggcatc
taccatgggggagaacccttatgtgacaatgtaaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggttgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacattgt
ccattggcctggggaaatataaacctgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttactgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcctagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtaattgaagagcatgccaattggtctgta
tcacgagaagcaggatttaactattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgacaaagaacagctccgagcaatttgtacacgagatcctctg
tctgaaatcactgagcaagaaaaagattttctatggagccacagacactattgtgtaact
atccctgaaattctgcccaaattgctcctgtctgttaagtggaattctagagatgaagta
gcccagatgtactgcttggtgaaagactggcctccaatcaaacctgaacaagccatggaa
cttctagactgtaattatccagatcctatggttcgaggatttgctgttcgatgcttggaa
aaatatttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacaatatttggataaccagcttgtgagatttttacttaagaaagctttgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagta
agtcagaggtttggcctgcttttggagtcctattgtcgtgcttgtgggatgtatttgaag
cacctgaatagacaagtcgaggctatggaaaaactcattaatttaactgacattctcaaa
caggagaagaaagatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgaga
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcaccaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttgcggcaagatatgttaacacttcaaattatacgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcggatgttgccttatggttgtttgtca
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcagatt
cagtgcaaaggcggcctaaaaggcgctctacagttcaacagccacacactacaccagtgg
ctcaaagacaaaaacaaaggagagatatatgatgcagccattgacttgtttacacgttcg
tgtgctggatattgtgtcgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtaccatttgttttgacacaagatttc
ttaatagtcattagtaaaggagcacaagaatgcacaaaaacaagagaatttgaaagattt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaattacaatcttttgatgatattgcc
tacattcgaaagaccctcgccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Trichechus manatus latirostris (Florida manatee): 101347746
Entry
101347746         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04670  Leukocyte transendothelial migration
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05020  Prion disease
tmu05100  Bacterial invasion of epithelial cells
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05146  Amoebiasis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101347746
   04014 Ras signaling pathway
    101347746
   04015 Rap1 signaling pathway
    101347746
   04370 VEGF signaling pathway
    101347746
   04630 JAK-STAT signaling pathway
    101347746
   04668 TNF signaling pathway
    101347746
   04066 HIF-1 signaling pathway
    101347746
   04068 FoxO signaling pathway
    101347746
   04070 Phosphatidylinositol signaling system
    101347746
   04072 Phospholipase D signaling pathway
    101347746
   04071 Sphingolipid signaling pathway
    101347746
   04024 cAMP signaling pathway
    101347746
   04151 PI3K-Akt signaling pathway
    101347746
   04152 AMPK signaling pathway
    101347746
   04150 mTOR signaling pathway
    101347746
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101347746
  09143 Cell growth and death
   04210 Apoptosis
    101347746
   04218 Cellular senescence
    101347746
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101347746
   04550 Signaling pathways regulating pluripotency of stem cells
    101347746
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101347746
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101347746
   04620 Toll-like receptor signaling pathway
    101347746
   04625 C-type lectin receptor signaling pathway
    101347746
   04650 Natural killer cell mediated cytotoxicity
    101347746
   04660 T cell receptor signaling pathway
    101347746
   04662 B cell receptor signaling pathway
    101347746
   04664 Fc epsilon RI signaling pathway
    101347746
   04666 Fc gamma R-mediated phagocytosis
    101347746
   04670 Leukocyte transendothelial migration
    101347746
   04062 Chemokine signaling pathway
    101347746
  09152 Endocrine system
   04910 Insulin signaling pathway
    101347746
   04923 Regulation of lipolysis in adipocytes
    101347746
   04929 GnRH secretion
    101347746
   04915 Estrogen signaling pathway
    101347746
   04914 Progesterone-mediated oocyte maturation
    101347746
   04917 Prolactin signaling pathway
    101347746
   04926 Relaxin signaling pathway
    101347746
   04935 Growth hormone synthesis, secretion and action
    101347746
   04919 Thyroid hormone signaling pathway
    101347746
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101347746
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101347746
  09156 Nervous system
   04725 Cholinergic synapse
    101347746
   04722 Neurotrophin signaling pathway
    101347746
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101347746
  09158 Development and regeneration
   04360 Axon guidance
    101347746
   04380 Osteoclast differentiation
    101347746
  09149 Aging
   04211 Longevity regulating pathway
    101347746
   04213 Longevity regulating pathway - multiple species
    101347746
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101347746
   05206 MicroRNAs in cancer
    101347746
   05205 Proteoglycans in cancer
    101347746
   05203 Viral carcinogenesis
    101347746
   05230 Central carbon metabolism in cancer
    101347746
   05231 Choline metabolism in cancer
    101347746
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101347746
  09162 Cancer: specific types
   05210 Colorectal cancer
    101347746
   05212 Pancreatic cancer
    101347746
   05225 Hepatocellular carcinoma
    101347746
   05226 Gastric cancer
    101347746
   05214 Glioma
    101347746
   05221 Acute myeloid leukemia
    101347746
   05220 Chronic myeloid leukemia
    101347746
   05218 Melanoma
    101347746
   05211 Renal cell carcinoma
    101347746
   05215 Prostate cancer
    101347746
   05213 Endometrial cancer
    101347746
   05224 Breast cancer
    101347746
   05222 Small cell lung cancer
    101347746
   05223 Non-small cell lung cancer
    101347746
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101347746
   05017 Spinocerebellar ataxia
    101347746
   05020 Prion disease
    101347746
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101347746
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101347746
   04932 Non-alcoholic fatty liver disease
    101347746
   04931 Insulin resistance
    101347746
   04933 AGE-RAGE signaling pathway in diabetic complications
    101347746
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101347746
   05100 Bacterial invasion of epithelial cells
    101347746
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101347746
   05170 Human immunodeficiency virus 1 infection
    101347746
   05161 Hepatitis B
    101347746
   05160 Hepatitis C
    101347746
   05171 Coronavirus disease - COVID-19
    101347746
   05164 Influenza A
    101347746
   05162 Measles
    101347746
   05168 Herpes simplex virus 1 infection
    101347746
   05163 Human cytomegalovirus infection
    101347746
   05167 Kaposi sarcoma-associated herpesvirus infection
    101347746
   05169 Epstein-Barr virus infection
    101347746
   05165 Human papillomavirus infection
    101347746
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101347746
   05142 Chagas disease
    101347746
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101347746
   01524 Platinum drug resistance
    101347746
   01522 Endocrine resistance
    101347746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101347746
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101347746
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 DUF4201 SH3_2 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Exonuc_VII_L
Other DBs
NCBI-GeneID: 101347746
NCBI-ProteinID: XP_004374584
UniProt: A0A2Y9DH33
LinkDB
Position
Unknown
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADSEQQALTLPDLAE
QFAPPDIAPPLLVKLVEAIEKKGLECSTLYRTQSSSSPAELRQLLDCDATSMDLEMIDVH
VLADAFKRYLLDLPNPVIPVAVYSEMISLAQEVQSSEEYIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQTASKNLLNGRVLSEIFSPMLFRFPAASSDNTEHLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVVNNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgagggataccagtacagagcgctgtatgattataaaaaggagcgagaagaa
gacattgacttgcatttgggtgacatactgactgtgaataaagggtccttggtagctctt
ggattcagtgacggacaggaagccaggcctgaagaaattggctggttgaatggctataat
gaaaccacgggggagaggggagactttccgggaacatatgtagaatatattggaaggaaa
aaaatctcacctcccacaccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcaaaaactgaagcagacagtgagcaacaagctttgactcttccggatcttgcagag
cagtttgcccctcctgacattgctccccctcttcttgtcaagctagtggaagccattgaa
aagaaaggtctggaatgttcaactctatatagaacacagagctctagcagcccagcagaa
ttacgacagcttcttgattgtgatgccacctccatggacttggaaatgatcgatgtgcac
gttttagcagacgctttcaaacgctatcttttggacttaccaaatcctgtcattccagta
gccgtttacagtgaaatgatttctttagcccaagaagtacagagctctgaagaatatatc
cagctgttgaagaagctcattaggtcacctaacatacctcatcagtattggcttacactt
cagtatttgctaaagcatttcttcaagctctctcaaaccgccagcaaaaatctcttgaat
ggaagagtactctctgaaattttcagccctatgcttttcagattcccagcagccagctct
gataatactgaacacctcataaaagttatcgaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacctactactgtagtcaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagctgatgggacatttttggtacgagatgcc
tctactaaaatgcatggagattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaactttcaactct
gtggttgaactaataaaccactaccggaatgagtctctcgctcagtataatcccaagctg
gatgtgaagttgctttatccagtctccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagttccaagaaaaaagt
cgggaatatgatagattatatgaagattatactcgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatctttgaagaacagtgccaaacc
caggagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgaaaagttaaagtcaagaatcagtgaaattgttgac
agtagaagaagattggaggaagacttgaagaagcaggcagctgagtatcgagagattgac
aaacgtatgaacagcattaaacctgacctcatccaactaagaaagacgagagaccagtac
ttgatgtggttgactcaaaaaggtgttcggcagaagaagttgaatgagtggctgggcaat
gaaaacactgaagaccaatactcgctggtggaagatgatgaggatttaccgcaccatgat
gagaagacctggaacgtgggtagcagcaaccggaacaaagctgagaacctattgcgaggg
aagcgggatggcactttccttgtccgcgagagcagtaaacagggctgctatgcttgctcc
gtagtggtggatggcgaggtaaagcactgtgtcatcaacaagacggcgactgggtatggc
tttgcggagccctataacttgtacagctccctgaaagaactggtgctacattaccaacac
acgtccctcgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Trichechus manatus latirostris (Florida manatee): 101351035
Entry
101351035         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04670  Leukocyte transendothelial migration
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05020  Prion disease
tmu05100  Bacterial invasion of epithelial cells
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05146  Amoebiasis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101351035
   04014 Ras signaling pathway
    101351035
   04015 Rap1 signaling pathway
    101351035
   04370 VEGF signaling pathway
    101351035
   04630 JAK-STAT signaling pathway
    101351035
   04668 TNF signaling pathway
    101351035
   04066 HIF-1 signaling pathway
    101351035
   04068 FoxO signaling pathway
    101351035
   04070 Phosphatidylinositol signaling system
    101351035
   04072 Phospholipase D signaling pathway
    101351035
   04071 Sphingolipid signaling pathway
    101351035
   04024 cAMP signaling pathway
    101351035
   04151 PI3K-Akt signaling pathway
    101351035
   04152 AMPK signaling pathway
    101351035
   04150 mTOR signaling pathway
    101351035
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101351035
  09143 Cell growth and death
   04210 Apoptosis
    101351035
   04218 Cellular senescence
    101351035
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101351035
   04550 Signaling pathways regulating pluripotency of stem cells
    101351035
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101351035
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101351035
   04620 Toll-like receptor signaling pathway
    101351035
   04625 C-type lectin receptor signaling pathway
    101351035
   04650 Natural killer cell mediated cytotoxicity
    101351035
   04660 T cell receptor signaling pathway
    101351035
   04662 B cell receptor signaling pathway
    101351035
   04664 Fc epsilon RI signaling pathway
    101351035
   04666 Fc gamma R-mediated phagocytosis
    101351035
   04670 Leukocyte transendothelial migration
    101351035
   04062 Chemokine signaling pathway
    101351035
  09152 Endocrine system
   04910 Insulin signaling pathway
    101351035
   04923 Regulation of lipolysis in adipocytes
    101351035
   04929 GnRH secretion
    101351035
   04915 Estrogen signaling pathway
    101351035
   04914 Progesterone-mediated oocyte maturation
    101351035
   04917 Prolactin signaling pathway
    101351035
   04926 Relaxin signaling pathway
    101351035
   04935 Growth hormone synthesis, secretion and action
    101351035
   04919 Thyroid hormone signaling pathway
    101351035
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101351035
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101351035
  09156 Nervous system
   04725 Cholinergic synapse
    101351035
   04722 Neurotrophin signaling pathway
    101351035
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101351035
  09158 Development and regeneration
   04360 Axon guidance
    101351035
   04380 Osteoclast differentiation
    101351035
  09149 Aging
   04211 Longevity regulating pathway
    101351035
   04213 Longevity regulating pathway - multiple species
    101351035
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101351035
   05206 MicroRNAs in cancer
    101351035
   05205 Proteoglycans in cancer
    101351035
   05203 Viral carcinogenesis
    101351035
   05230 Central carbon metabolism in cancer
    101351035
   05231 Choline metabolism in cancer
    101351035
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101351035
  09162 Cancer: specific types
   05210 Colorectal cancer
    101351035
   05212 Pancreatic cancer
    101351035
   05225 Hepatocellular carcinoma
    101351035
   05226 Gastric cancer
    101351035
   05214 Glioma
    101351035
   05221 Acute myeloid leukemia
    101351035
   05220 Chronic myeloid leukemia
    101351035
   05218 Melanoma
    101351035
   05211 Renal cell carcinoma
    101351035
   05215 Prostate cancer
    101351035
   05213 Endometrial cancer
    101351035
   05224 Breast cancer
    101351035
   05222 Small cell lung cancer
    101351035
   05223 Non-small cell lung cancer
    101351035
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101351035
   05017 Spinocerebellar ataxia
    101351035
   05020 Prion disease
    101351035
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101351035
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101351035
   04932 Non-alcoholic fatty liver disease
    101351035
   04931 Insulin resistance
    101351035
   04933 AGE-RAGE signaling pathway in diabetic complications
    101351035
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101351035
   05100 Bacterial invasion of epithelial cells
    101351035
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101351035
   05170 Human immunodeficiency virus 1 infection
    101351035
   05161 Hepatitis B
    101351035
   05160 Hepatitis C
    101351035
   05171 Coronavirus disease - COVID-19
    101351035
   05164 Influenza A
    101351035
   05162 Measles
    101351035
   05168 Herpes simplex virus 1 infection
    101351035
   05163 Human cytomegalovirus infection
    101351035
   05167 Kaposi sarcoma-associated herpesvirus infection
    101351035
   05169 Epstein-Barr virus infection
    101351035
   05165 Human papillomavirus infection
    101351035
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101351035
   05142 Chagas disease
    101351035
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101351035
   01524 Platinum drug resistance
    101351035
   01522 Endocrine resistance
    101351035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101351035
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101351035
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638
Other DBs
NCBI-GeneID: 101351035
NCBI-ProteinID: XP_004371850
UniProt: A0A2Y9DBZ1
LinkDB
Position
Unknown
AA seq 462 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVANGMKDSSASS
LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRD
GKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGK
KLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKE
YIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIK
PDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFMNEEDENLPHYDEKTWF
VEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPY
NLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttgcaaatggaatgaaggacagttctgcttcttct
cttcaggatgcagaatggtactggggggatatttcaagggaggaagtaaatgacaaatta
cgggacatgccagatggtaccttcttggtccgagatgcctcaacaaaaatgcaaggagat
tatactttgactttgcggaagggaggcaataataagttaataaagatctatcatcgggat
ggtaaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccac
tatcatcatgaatctcttgctcaatacaatcccaaacttgatgtgaagctgatgtaccca
gtgtccagataccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaa
aaactgcaagagtaccactctcagtatcaggaaaagagtaaagagtatgacaggctatat
gaggaatataccaggacatcccaggaaatacagatgaagaggactgcaattgaagctttt
aatgaaacaattaaaatatttgaggaacagtgtcacacacaagaacaacatagcaaagaa
tatattgagcgatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaat
tatgacaaattgaaatcacgtctgggtgagatacatgatagcaaaatgcgtctagagcag
gatttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaatagtatcaaa
cctgacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaa
ggagtgagacagaagcgtctgaatgcctggctgggaatcaagaatgaggatgccgatgag
acctattttatgaatgaggaagatgaaaacttgccccattatgatgagaaaacctggttt
gttgaggatatcaatcgagtacaagcagaagacctgctttatggaaaacctgatggagca
ttcttaattcgagagagtagcaagaaaggatgctatgcttgctctgtggttgccgatggg
gaagtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctac
aacctgtacagctcactgaaggagctggtgctccattaccagcagacatcccttgttcag
cacaacgactccctcaacgtcaggcttgcctaccctgtccatgcacagatgccctcgctc
tgcagataa

KEGG   Trichechus manatus latirostris (Florida manatee): 101358678
Entry
101358678         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00562  Inositol phosphate metabolism
tmu01100  Metabolic pathways
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04670  Leukocyte transendothelial migration
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05020  Prion disease
tmu05100  Bacterial invasion of epithelial cells
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05146  Amoebiasis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101358678
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101358678
   04014 Ras signaling pathway
    101358678
   04015 Rap1 signaling pathway
    101358678
   04370 VEGF signaling pathway
    101358678
   04630 JAK-STAT signaling pathway
    101358678
   04668 TNF signaling pathway
    101358678
   04066 HIF-1 signaling pathway
    101358678
   04068 FoxO signaling pathway
    101358678
   04070 Phosphatidylinositol signaling system
    101358678
   04072 Phospholipase D signaling pathway
    101358678
   04071 Sphingolipid signaling pathway
    101358678
   04024 cAMP signaling pathway
    101358678
   04151 PI3K-Akt signaling pathway
    101358678
   04152 AMPK signaling pathway
    101358678
   04150 mTOR signaling pathway
    101358678
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101358678
  09143 Cell growth and death
   04210 Apoptosis
    101358678
   04218 Cellular senescence
    101358678
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101358678
   04550 Signaling pathways regulating pluripotency of stem cells
    101358678
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101358678
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101358678
   04620 Toll-like receptor signaling pathway
    101358678
   04625 C-type lectin receptor signaling pathway
    101358678
   04650 Natural killer cell mediated cytotoxicity
    101358678
   04660 T cell receptor signaling pathway
    101358678
   04662 B cell receptor signaling pathway
    101358678
   04664 Fc epsilon RI signaling pathway
    101358678
   04666 Fc gamma R-mediated phagocytosis
    101358678
   04670 Leukocyte transendothelial migration
    101358678
   04062 Chemokine signaling pathway
    101358678
  09152 Endocrine system
   04910 Insulin signaling pathway
    101358678
   04923 Regulation of lipolysis in adipocytes
    101358678
   04929 GnRH secretion
    101358678
   04915 Estrogen signaling pathway
    101358678
   04914 Progesterone-mediated oocyte maturation
    101358678
   04917 Prolactin signaling pathway
    101358678
   04926 Relaxin signaling pathway
    101358678
   04935 Growth hormone synthesis, secretion and action
    101358678
   04919 Thyroid hormone signaling pathway
    101358678
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101358678
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101358678
  09156 Nervous system
   04725 Cholinergic synapse
    101358678
   04722 Neurotrophin signaling pathway
    101358678
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101358678
  09158 Development and regeneration
   04360 Axon guidance
    101358678
   04380 Osteoclast differentiation
    101358678
  09149 Aging
   04211 Longevity regulating pathway
    101358678
   04213 Longevity regulating pathway - multiple species
    101358678
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101358678
   05206 MicroRNAs in cancer
    101358678
   05205 Proteoglycans in cancer
    101358678
   05203 Viral carcinogenesis
    101358678
   05230 Central carbon metabolism in cancer
    101358678
   05231 Choline metabolism in cancer
    101358678
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101358678
  09162 Cancer: specific types
   05210 Colorectal cancer
    101358678
   05212 Pancreatic cancer
    101358678
   05225 Hepatocellular carcinoma
    101358678
   05226 Gastric cancer
    101358678
   05214 Glioma
    101358678
   05221 Acute myeloid leukemia
    101358678
   05220 Chronic myeloid leukemia
    101358678
   05218 Melanoma
    101358678
   05211 Renal cell carcinoma
    101358678
   05215 Prostate cancer
    101358678
   05213 Endometrial cancer
    101358678
   05224 Breast cancer
    101358678
   05222 Small cell lung cancer
    101358678
   05223 Non-small cell lung cancer
    101358678
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101358678
   05017 Spinocerebellar ataxia
    101358678
   05020 Prion disease
    101358678
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101358678
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101358678
   04932 Non-alcoholic fatty liver disease
    101358678
   04931 Insulin resistance
    101358678
   04933 AGE-RAGE signaling pathway in diabetic complications
    101358678
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101358678
   05135 Yersinia infection
    101358678
   05100 Bacterial invasion of epithelial cells
    101358678
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101358678
   05170 Human immunodeficiency virus 1 infection
    101358678
   05161 Hepatitis B
    101358678
   05160 Hepatitis C
    101358678
   05171 Coronavirus disease - COVID-19
    101358678
   05164 Influenza A
    101358678
   05162 Measles
    101358678
   05168 Herpes simplex virus 1 infection
    101358678
   05163 Human cytomegalovirus infection
    101358678
   05167 Kaposi sarcoma-associated herpesvirus infection
    101358678
   05169 Epstein-Barr virus infection
    101358678
   05165 Human papillomavirus infection
    101358678
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101358678
   05142 Chagas disease
    101358678
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101358678
   01524 Platinum drug resistance
    101358678
   01522 Endocrine resistance
    101358678
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101358678
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101358678
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101358678
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD Tom37_C DUF4381
Other DBs
NCBI-GeneID: 101358678
NCBI-ProteinID: XP_023591787
UniProt: A0A2Y9RBH4
LinkDB
Position
Unknown
AA seq 1082 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSVPVDFLLPTGIYIQLEVPREATISHIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGD
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLVGLSWMDWLKHTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAVQKRLTIHGKEDE
VNPYDYVLQVSGRIEYVFGDHPLIQFQYIRNCVMNRTLPHFTLVECCKIKKMYEQEMIAI
DAAINRNSSNLPLPLPPKKTRIISVGFMGEPLITPKHVWENNHPFQIVLVKGNKLNTEET
VKVHVRAGLFHGTELLCKTIVSAEISGKSDHIWNELLEFDINTCDLPRMARLCFAVYAVL
DKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDITLHSWSSFPDE
LEEMLNPMGTVQTNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDGANVSS
RGGKKFLAVLKEILDRDPLSQLCENETDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDV
AQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVSCLRQMSDEELSQYLLQLVQVLKY
EPFLDCALSRFLLERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKV
LSKQVEALNKLKTLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVIL
SELYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWK
EAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEY
NSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSK
FGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGSLFITLFALML
TAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDY
KS
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacattcttgacatctgggcagtg
gattcacagatagcatctgatggctccgtacctgtggatttccttttgcccactgggatc
tatatccagttggaggtacctcgggaagctaccatttctcatattaagcagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaaccagaagactatgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggat
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattcagaagaaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttgtaggattgtcttggatggactggctaaagcatacatatccaccagagcac
gaaccatccatccttgagaacttagaagataaactttacggaggaaagcttattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtgtctcctaatatgaatcct
ataaaaataaatgaattggcagtccaaaaacgtttgactattcatgggaaagaagatgaa
gttaacccctatgactatgtgttgcaagtcagtgggagaatagaatatgtgtttggtgat
catccactaattcagttccagtatatcaggaactgtgtaatgaacaggaccctgccccat
tttacactcgtggaatgctgtaagatcaagaagatgtatgagcaggaaatgattgccata
gatgctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaaca
cgaattatttctgtaggtttcatgggtgaacctttgataaccccaaagcatgtttgggaa
aataaccaccctttccagattgtcttggttaagggaaataaacttaacacagaagaaacc
gtaaaagttcacgtcagggctggtctctttcatggtactgagctcttgtgtaaaaccatc
gtaagtgcagagatatcagggaaaagtgatcacatttggaatgaactactggaatttgat
attaatacttgcgaccttccaagaatggctcgattgtgttttgctgtttatgcagttttg
gataaagtaaaaacgaagaaatcaactaaaactattaatccctctaaatatcaaactatc
aggaaagctggaaaagtgcattatcctgtagcctgggtaaatacaatggtttttgacttt
aaaggacagttgaggtctggagacataacattgcacagctggtcttcatttcctgatgaa
cttgaagaaatgttgaatccaatgggaactgttcagacaaatccgtataccgaaaatgca
acagctttgcatattaaattcccagagaataaaaaacaaccttattattaccctcccttc
gataagattattgaaaaggcagctgagattgcaagcagtgatggtgctaatgtatcaagt
cgaggtggaaaaaagtttcttgctgtactgaaagaaatcttggacagggatcccttatct
caactatgtgagaatgaaacggaccttatttggactttacgacaagactgcagagagaat
ttcccacagtcactgccaaaattattgctgtctatcaagtggaataaactcgaagatgtt
gctcagcttcaggcacttcttcagatctggcctaaattgcccccccgggaggccctggag
cttctggatttcaattatccagaccagtacgtgcgggaatatgctgtgagttgcctgcga
cagatgagtgatgaagaactctctcaatatcttttacagctggtgcaagtgttaaaatat
gagccttttcttgattgtgccctctctcgattcctattagaaagagcacttgctaatcgg
aggatagggcagtttctgttttggcatcttaggtcagaagtacacattcctgctgtctcg
gtacaatttggtgtcatccttgaagcatactgtcggggaagtgtaggccacatgaaagtg
ctttccaagcaggttgaagcacttaacaagttaaaaactttaaatagtttaatcaaactg
aatgcaatgaagctaaacagagccaaagggaaggaggccatgcacacctgtttaaaacag
aatgcttaccgggaagccctctctgacctacagtcgcctctgaacccatgtgtcatcctc
tcagaactctatgttgaaaagtgcaaatacatggattccaagatgaagcctttgtggctg
gtgtacaacaacaaagtgtttggtgaggattcagtcggagtgatttttaaaaacggtgat
gatttacgacaggatatgttgacactgcagatgctgcgcttgatggatttactctggaaa
gaagctggtctagatcttcggatgcttccttatggctgtttagcaacaggagaccgctct
ggcctgattgaagttgtgagcacctctgaaacaattgctgacatacagctgaacagtagc
aatgtggcagctgctgcagccttcaacaaagatgcccttctgaactggcttaaagaatac
aattctggggatgacctggaccgagctattgaggagtttaccctgtcctgtgctggctac
tgtgtagcttcttatgtccttgggattggtgacagacatagcgacaacatcatggtcaag
aaaactggccagctcttccacattgactttggacatattcttggaaacttcaagtctaaa
tttggcattaaaagggagcgagtgccttttattcttacctatgatttcattcatgtgatt
caacaaggaaaaacaggaaacacggaaaagtttggccggttccgccagtgttgtgaggat
gcgtatctgatcttacgacggcatgggagtctcttcattactctgtttgcgttgatgttg
actgcagggcttcctgagctcacgtcagtcaaggatatacagtatctcaaggattctctt
gccttagggaagagtgaagaagaagcactcaaacaattcaagcaaaaatttgatgaggca
ctcagggaaagctggactactaaagtaaactggatggcccacacagttcggaaagactac
aaatcttaa

KEGG   Trichechus manatus latirostris (Florida manatee): 101359658
Entry
101359658         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X2
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00562  Inositol phosphate metabolism
tmu01100  Metabolic pathways
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04670  Leukocyte transendothelial migration
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05020  Prion disease
tmu05100  Bacterial invasion of epithelial cells
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05146  Amoebiasis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101359658
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101359658
   04014 Ras signaling pathway
    101359658
   04015 Rap1 signaling pathway
    101359658
   04370 VEGF signaling pathway
    101359658
   04630 JAK-STAT signaling pathway
    101359658
   04668 TNF signaling pathway
    101359658
   04066 HIF-1 signaling pathway
    101359658
   04068 FoxO signaling pathway
    101359658
   04070 Phosphatidylinositol signaling system
    101359658
   04072 Phospholipase D signaling pathway
    101359658
   04071 Sphingolipid signaling pathway
    101359658
   04024 cAMP signaling pathway
    101359658
   04151 PI3K-Akt signaling pathway
    101359658
   04152 AMPK signaling pathway
    101359658
   04150 mTOR signaling pathway
    101359658
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101359658
  09143 Cell growth and death
   04210 Apoptosis
    101359658
   04218 Cellular senescence
    101359658
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101359658
   04550 Signaling pathways regulating pluripotency of stem cells
    101359658
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101359658
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101359658
   04620 Toll-like receptor signaling pathway
    101359658
   04625 C-type lectin receptor signaling pathway
    101359658
   04650 Natural killer cell mediated cytotoxicity
    101359658
   04660 T cell receptor signaling pathway
    101359658
   04662 B cell receptor signaling pathway
    101359658
   04664 Fc epsilon RI signaling pathway
    101359658
   04666 Fc gamma R-mediated phagocytosis
    101359658
   04670 Leukocyte transendothelial migration
    101359658
   04062 Chemokine signaling pathway
    101359658
  09152 Endocrine system
   04910 Insulin signaling pathway
    101359658
   04923 Regulation of lipolysis in adipocytes
    101359658
   04929 GnRH secretion
    101359658
   04915 Estrogen signaling pathway
    101359658
   04914 Progesterone-mediated oocyte maturation
    101359658
   04917 Prolactin signaling pathway
    101359658
   04926 Relaxin signaling pathway
    101359658
   04935 Growth hormone synthesis, secretion and action
    101359658
   04919 Thyroid hormone signaling pathway
    101359658
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101359658
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101359658
  09156 Nervous system
   04725 Cholinergic synapse
    101359658
   04722 Neurotrophin signaling pathway
    101359658
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101359658
  09158 Development and regeneration
   04360 Axon guidance
    101359658
   04380 Osteoclast differentiation
    101359658
  09149 Aging
   04211 Longevity regulating pathway
    101359658
   04213 Longevity regulating pathway - multiple species
    101359658
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101359658
   05206 MicroRNAs in cancer
    101359658
   05205 Proteoglycans in cancer
    101359658
   05203 Viral carcinogenesis
    101359658
   05230 Central carbon metabolism in cancer
    101359658
   05231 Choline metabolism in cancer
    101359658
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101359658
  09162 Cancer: specific types
   05210 Colorectal cancer
    101359658
   05212 Pancreatic cancer
    101359658
   05225 Hepatocellular carcinoma
    101359658
   05226 Gastric cancer
    101359658
   05214 Glioma
    101359658
   05221 Acute myeloid leukemia
    101359658
   05220 Chronic myeloid leukemia
    101359658
   05218 Melanoma
    101359658
   05211 Renal cell carcinoma
    101359658
   05215 Prostate cancer
    101359658
   05213 Endometrial cancer
    101359658
   05224 Breast cancer
    101359658
   05222 Small cell lung cancer
    101359658
   05223 Non-small cell lung cancer
    101359658
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101359658
   05017 Spinocerebellar ataxia
    101359658
   05020 Prion disease
    101359658
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101359658
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101359658
   04932 Non-alcoholic fatty liver disease
    101359658
   04931 Insulin resistance
    101359658
   04933 AGE-RAGE signaling pathway in diabetic complications
    101359658
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101359658
   05135 Yersinia infection
    101359658
   05100 Bacterial invasion of epithelial cells
    101359658
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101359658
   05170 Human immunodeficiency virus 1 infection
    101359658
   05161 Hepatitis B
    101359658
   05160 Hepatitis C
    101359658
   05171 Coronavirus disease - COVID-19
    101359658
   05164 Influenza A
    101359658
   05162 Measles
    101359658
   05168 Herpes simplex virus 1 infection
    101359658
   05163 Human cytomegalovirus infection
    101359658
   05167 Kaposi sarcoma-associated herpesvirus infection
    101359658
   05169 Epstein-Barr virus infection
    101359658
   05165 Human papillomavirus infection
    101359658
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101359658
   05142 Chagas disease
    101359658
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101359658
   01524 Platinum drug resistance
    101359658
   01522 Endocrine resistance
    101359658
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101359658
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101359658
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101359658
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 101359658
NCBI-ProteinID: XP_004385197
UniProt: A0A2Y9E158
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPFFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLV
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWEAWLQYSFPLQLEPAARGWGT
GTLRVPNRVLLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVERPEDYA
LQVNGKYEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPTPQVQKLR
TKPPPIPVKKPSSASLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKMVSS
SEVSVCSGPVWNQRLEFDINICDLPRMARLCLALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGEQCLYMWPFVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
HPVYYPALEKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
YFPEALARLLLVTKWNKHEDVAQMLCLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHVCMR
QETYLEALSHLQSPLDPSTLLADVCVEQCTFMDSKMKPLWIMYSNEEAGSEGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRGYC
EKAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccctatggaattctggaccaaggaggagaaccagagcgtg
gcggttgacttcttgctgcccacgggtgtctatctgaacttccctgtgtcccgcaatgcc
aacctcagtaccatcaagcaggtgttgtggcaccgcgcccagtatgagcccttcttccac
atgctcagcgaccccgaggcctatgtgttcacctgcgtcaaccagacagcggaacagcag
gagctggaggacgagcagcgtcgactctgtgacatccaacccttcctgccagtcctgcgc
ctggtggcccgtgagggcgaccgtgtgaagaagctcatcaattcacagatcagccttgtc
atcggcaaaggcctccatgagttcgactccttgcgagacccggaggtgaacgacttccgc
accaagatgcgccagttctgcgaggaggcagccgcgcaccggcagcagctgggctgggag
gcctggctgcagtacagcttccctctgcagctggagcctgcggcgcggggctggggcact
ggcaccctgcgcgtccccaaccgggtcctcctagtcaatgtcaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctggcgctgatggcctgtgcc
ctccggaagaaggctaccgtgttccggcagccgctggtggagcggccggaggactatgcg
ctgcaggtgaatgggaagtacgagtacctctacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgacccctcacctgaccatggtgcactcctcc
tccatcttggccatgcgggatgagcagagcaaccccacgccccaggtccagaagctgcgc
accaagccgccccccattcctgtgaagaagccctcctctgcatccctgtggtccctggag
cagccgttttgcatcgagctgatccagggcagcaaagtgaatgccgatgagcgtatgaag
ctggtggtgcaggctgggctcttccacggcaacgagatgctgtgcaaaatggtgtccagc
tcagaggtgagcgtgtgctcagggcccgtgtggaaccagcggctggagttcgacatcaac
atctgtgacctgccccgaatggcccggctctgcctcgcgctttacgctgtgattgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactataaggaccagctcaagaccggggagcagtgcctctac
atgtggccctttgtcccagacgagaaaggggagctgctgaaccccacagggactgtgcgg
agtaatcctaacacagagagtgccgctgccctggtcatctgcctccccgaggtggcccct
catcccgtgtactaccctgccctggagaagatcctggagctggggcggcacggggagcac
gggcgcttcaccgaggaggagcagctgcagttgcgggaaatcctggagcggcgcggctcg
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcgccatgaggtccaggag
tacttccctgaggctctggcccggctgctgctggtcactaagtggaacaagcacgaggac
gtggcccagatgctctgcctgctgtgttcatggcccgagctgcccgtcctgagtgccctg
gagctgctggacttcagtttcccggaccgccacgtgggctcctttgccatcaagtccctg
cgcaagctgacggacgatgagcttttccagtacctgctgcagctggtgcaggtactcaag
tatgagtcctacctggactgtgagctgaccaagtttctgctggaccgggcactggccaac
cgcaagatcggtcacttcctcttctggcacctccgctccgagatgcatgttccatcggtg
gccctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaagctgaaggccctgaatgattttgtcaaa
gtgagctcccagaagaccaccaagccgcaaaccaaggagatgatgcatgtgtgcatgcgt
caggagacctacctggaggctctctcccacctgcagtccccactcgaccccagcacgctg
ctggctgacgtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctatgg
atcatgtacagcaatgaggaggcgggcagtgagggcagcgtgggcatcatcttcaagaat
ggggatgatctccgccaggacatgctgactctgcaaatgatccagctcatggacgttctg
tggaagcaggaggggctggacctgaggatgaccccctatggctgcctctccaccggggac
cgcacaggcctcatcgaagtagtgctccactcagacaccatcgccaacatccagctaaac
aagagcaacatggcagccacagctgcctttaacaaggatgccctgctcaactggctcaag
tccaagaacccaggggaggccctggaccgagccatcgaggagttcaccctttcctgtgct
ggctactgtgtggccacctatgtgctgggcatcggcgatcggcacagtgacaacatcatg
atccgtgaaagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgaacgagtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagacgaacaacaatgagaagtttgaaaggttccgaggctactgt
gagaaagcctacaccatcctgcggcgccacgggctgctctttctccacctctttgctctc
atgagggcagcaggcctgcctgaactcagctgctcaaaagacatccagtatctcaaggac
tccctggcattggggaaaacggaggaggaagcactcaagcacttccgggtcaagtttaat
gaagccctgcgggagagctggaaaaccaaagtgaactggttggcccacaatgtgtctaaa
gacaacaggcagtag

DBGET integrated database retrieval system