KEGG   Trichechus manatus latirostris (Florida manatee): 101343808
Entry
101343808         CDS       T05135                                 

Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04012  ErbB signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04136  Autophagy - other
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04371  Apelin signaling pathway
tmu04613  Neutrophil extracellular trap formation
tmu04630  JAK-STAT signaling pathway
tmu04659  Th17 cell differentiation
tmu04714  Thermogenesis
tmu04910  Insulin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05014  Amyotrophic lateral sclerosis
tmu05016  Huntington disease
tmu05017  Spinocerebellar ataxia
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101343808
   04371 Apelin signaling pathway
    101343808
   04630 JAK-STAT signaling pathway
    101343808
   04066 HIF-1 signaling pathway
    101343808
   04072 Phospholipase D signaling pathway
    101343808
   04151 PI3K-Akt signaling pathway
    101343808
   04152 AMPK signaling pathway
    101343808
   04150 mTOR signaling pathway
    101343808
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101343808
   04136 Autophagy - other
    101343808
  09143 Cell growth and death
   04218 Cellular senescence
    101343808
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101343808
   04659 Th17 cell differentiation
    101343808
  09152 Endocrine system
   04910 Insulin signaling pathway
    101343808
   04920 Adipocytokine signaling pathway
    101343808
   04935 Growth hormone synthesis, secretion and action
    101343808
   04919 Thyroid hormone signaling pathway
    101343808
  09149 Aging
   04211 Longevity regulating pathway
    101343808
   04213 Longevity regulating pathway - multiple species
    101343808
  09159 Environmental adaptation
   04714 Thermogenesis
    101343808
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343808
   05206 MicroRNAs in cancer
    101343808
   05205 Proteoglycans in cancer
    101343808
   05230 Central carbon metabolism in cancer
    101343808
   05231 Choline metabolism in cancer
    101343808
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101343808
  09162 Cancer: specific types
   05210 Colorectal cancer
    101343808
   05212 Pancreatic cancer
    101343808
   05225 Hepatocellular carcinoma
    101343808
   05226 Gastric cancer
    101343808
   05214 Glioma
    101343808
   05221 Acute myeloid leukemia
    101343808
   05215 Prostate cancer
    101343808
   05224 Breast cancer
    101343808
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101343808
   05014 Amyotrophic lateral sclerosis
    101343808
   05016 Huntington disease
    101343808
   05017 Spinocerebellar ataxia
    101343808
   05022 Pathways of neurodegeneration - multiple diseases
    101343808
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101343808
   04931 Insulin resistance
    101343808
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101343808
   05168 Herpes simplex virus 1 infection
    101343808
   05163 Human cytomegalovirus infection
    101343808
   05167 Kaposi sarcoma-associated herpesvirus infection
    101343808
   05165 Human papillomavirus infection
    101343808
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101343808
   01522 Endocrine resistance
    101343808
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343808
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101343808
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101343808
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101343808
Membrane trafficking [BR:tmu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101343808
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 101343808
NCBI-ProteinID: XP_004385222
UniProt: A0A2Y9E154
LinkDB
Position
Unknown
AA seq 2550 aa
MLGTGPAAATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSQHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLDYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKVDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSTRKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHTSGANITNTTTAATTAATAAATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPIQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgcttggaacaggacctgccgccgccaccacagctaccaccacatcgagcaatgtgagc
gttttgcagcagtttgccagtggcctgaagagccgcaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
acccgcttctatgatcagctgaaccatcacatttttgagttagtctccagctccgatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaatcggcagatttgctaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgcctcgccatggcaggagacactttt
actgctgagtatgtggagtttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aacgagggccggagacatgcagcggttctggttctccgtgagctggccatcagcgttccc
accttcttcttccagcaagtgcaacccttctttgacaacatatttgtggccgtgtgggac
cccaaacaggccatccgggagggagccgtagctgccctccgcgcctgtctgattctcacc
acccagcgtgagccaaaggagatgcagaagcctcagtggtataggcacacatttgaagaa
gcagagaaagggtttgatgagaccttggccaaggagaagggcatgaatcgggatgaccgg
atccatggagccttgctgattctcaacgaactggtccgcatcagcagcatggagggagag
cgtctaagagaagaaatggaagaaatcacacagcagcagctggtacatgacaagtactgc
aaagatctcatgggcttcgggacaaaacctcggcacatcaccccgttcaccagtttccaa
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctgatgggatttggggcttcccctagcccagctaaatccaccctggtggagagccgg
tgttgcagagacttgatggaggagaagtttgatcaggtgtgccagtgggtgctgaaatgc
agaaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtt
ctaagctgtgtcaaaaaggagaaggaacgtacagcagccttccaggccctggggttactt
tctgtggccgtgaggtctgagtttaaggtctatttacctcgtgtactggacatcatccga
gcagccctgccccctaaggacttcgcccataagagacagaaggcgatgcaggtggatgcc
acagtgttcacctgcatcagcatgctagctcgggcaatggggcctggcatccagcaggat
atcaaggagctgctggagcctatgctagcagtgggactgagccctgctctcactgctgtg
ctctatgacctgagccgccaaatcccgcagctgaagaaggacatccaggatgggctactg
aagatgctgtccttggtcctcatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcatcactctagcccttcgaactcttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgccactgtgcagatcacttcttgaacagtgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagactgcagtgcaggtggtggcagatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatctctggat
gagcgctttgatgcacacctggcccaggcagagaacttgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccggctcagtagc
atgaatccagcctttgtcatgccttttctgcgcaagatgctcatacagatcttgacagag
ctggagcacagtggcattggaagaatcaaagagcagagcgcccgcatgctgggacacctg
gtctccaatgctccccgactcatccgcccctacatggagcctattttgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaaccctggtgtgatcaataatgtcttggct
acaataggagaattggctcaggttagtggcctagaaatgaggaagtgggttgatgaactt
tttattatcatcatggacatgctccaggactcctctcttttggccaaaaggcaggtggct
ctgtggaccctgggacaattggtggccagcactggctatgttgtagagccctacaggaag
taccccactctgcttgaggtgctgctgaattttctgaagactgagcagaaccagggtaca
cggagagaggccattcgtgtattagggctcttgggggcgttggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgggatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcctctggatgagttctacccagccgtttccatggtggccctgatgcggatcttccgg
gaccagtccctctctcagcatcacaccatggttgtccaagccatcaccttcatcttcaag
tccctgggactcaagtgtgtacagttcctgccccaggtcatgcccacattccttaatgtc
attcgggtctgtgacggggccatccgggagtttctgttccagcaactgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaatccaaagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggagaatttaaactctacctgccccagctgatcccacatatgcttcga
gtcttcatgcatgacaacagcccgggccgcatcgtctctatcaagttgttggctgcaatc
cagctgtttggcgccaacctggatgactatctgcatttgttgttgcctcctattgtgaag
ttgtttgatgcccctgaagttccactaccgtctcgaaaggcagcgttagagacagtggac
cgcctgactgagtccctggacttcaccgactatgcctcccggatcattcatcctattgtt
cgcacgctggaccagagcccagaactgcgttccacagccatggacacgttgtcttcactt
gtctttcaactggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaaccatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acccttgctgatgaagaggaggaccctttgatttaccagcatcgaatgctgaggagcggc
caaggggatgcactggctagtggaccagtagagacgggacccatgaagaaactgcacgtc
agcaccattaacctccaaaaggcctggggagctgccaggagggtttccaaagatgactgg
ctggagtggctgagacggctgagcctggagctactgaaggattcctcgtctccctccctg
cgctcatgctgggccctggcacaggcctacaacccaatggccagggacctcttcaatgct
gcatttgtgtcctgctggtctgaattgaatgaagaccagcaggatgagctcatcagaagc
attgagttggccctcacctcacaagacatcgctgaagtcacacaaaccctcctaaacttg
gccgaattcatggaacacagtgacaagggcccactaccactgagagatgacaatggcatt
gtcctgctgggtgagagagcggccaagtgccgagcatatgccaaagcacttcactacaaa
gaactggagttccagaaaggccccactccggccattctagagtctctcatcagcattaat
aataagctacagcagccagaggcagctgccggggtgttagactatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaggatgctctt
gtggcctatgataagaaggtggacaccaacaaggatgaccccgagctgatgctgggccgc
atgcgctgccttgaggccttgggggagtgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagactcaggccaagatggcccggatggctgctgcagccgca
tggggtttaggtcagtgggatagcatggaagaatacacctgtatgatccctcgggacacc
cacgatggggcattttatagagctgtgctggcgctacatcaggacctcttctcattggcg
caacagtgtatcgacaaagccagggacctgctggatgctgagttaactgctatggcagga
gagagctacagtcgggcatatggggccatggtttcttgccacatgctctccgagctggag
gaggttatccagtacaaacttgtccctgagcgacgcgagatcatccgccagatctggtgg
gaaagactgcagggctgccagcgtattgtggaggattggcagaaaatccttatggtgcgc
tcccttgtagtcagccctcacgaggacatgagaacatggctcaagtatgcaagcctgtgt
ggcaagagtggtagactggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccatctcgtcaacttgaccatcctctgccaacagttcaccctcaggtcacctatgcatac
atgaaaaacatgtggaagagcactcgcaagatcgatgccttccagcacatgcagcacttt
gtccagacaatgcagcagcaggcccagcatgccatcgccaccgaggaccagcagcacaag
caagagctgcacaagctcatggcccgatgtttcctgaaacttggggagtggcagctgaac
ctacagggcatcaacgagagcacaatccccaaagtcctgcagtactacagcgctgccaca
gagcatgaccgcagctggtacaaggcctggcacgcatgggcagtgatgaactttgaagct
gtgctgcactacaaacatcagaaccaagcccgtgatgagaagaagaaactgcgtcacacc
agtggggccaacatcaccaacaccaccactgctgccaccacagcagccactgccgctgcc
actgccaccagcacggagggcagcaacagcgagagcgaagctgagagcactgagaacagc
cctaccccatctcccctgcagaagaaggtcactgaggatttgtccaagaccctcttgatg
tacactgtccctgccgtccagggcttcttccgttcaatctctttgtcacgaggcaacaac
ctccaggatacgctcagagtcctcactttatggtttgattatggtcactggccagatgta
aatgaagctttagtggaaggggtgaaagcgatccagattgatacttggttacaggttata
cctcaactcatcgcaagaattgatacgcccaggcccttggtgggacgtctcattcaccag
cttctcaccgacattgggcgataccatccccaggccctcatctaccccctgactgtggct
tctaagtcgaccaccacagcccgtcacaatgcagccaacaagattctgaagaacatgtgt
gagcacagtaacaccctggtacagcaggccatgatggtgagtgaggagctgatccgagtg
gccatcctctggcatgagatgtggcacgaaggcctggaagaggcatctcgcttgtacttt
ggggagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaa
cgggggccccagaccctgaaggaaacatccttcaatcaggcatatggtcgagatttaatg
gaggcccaagagtggtgcaggaagtacatgaaatcaggcaatgtcaaggacctcacccaa
gcctgggacctctattatcatgtgttcagacgaatctcaaagcaactgcctcagcttaca
tccttagagctgcaatacgtctccccaaaacttctgatgtgccgggaccttgaattggct
gtgccaggaacgtatgaccccaaccagccgatcattcgcattcagtccatagcaccgtct
ttgcaagtcatcacatccaagcagaggccccggaagttgacacttatgggcagcaatggg
cacgagtttgttttcctcctgaagggccacgaagacctgcgacaagacgagcgggtgatg
cagctcttcggcctggttaacaccctgctagccaacgacccaacctctctccggaaaaac
ctcagcatccagaggtatgccgtcatccctttatcaaccaactcgggcctgatcggctgg
gtcccccactgtgacacactgcacgccctcatccgggactacagggagaaaaagaaaatc
ctcctcaacattgagcatcgcatcatgttacggatggctccggactatgaccacttgact
ctaatgcagaaggtggaggtgtttgagcacgctgttaacaacaccgcaggggatgacctg
gccaagcttctgtggctgaagagccccagctcagaggtgtggtttgaccgaagaaccaat
tacacccgctctttagcagtcatgtctatggttgggtatattttgggcctgggagatagg
cacccatccaacttgatgcttgaccggctgagtgggaagatcctgcacattgactttggg
gactgctttgaggttgctatgaccagggagaaattcccagagaagattccatttagacta
acgagaatgttgaccaatgctatggaggttactggcctggatggcaactacagaatcaca
tgccacacagtgatggaagtgcttcgggaacacaaggatagtgtcatggctgtgctggaa
gccttcgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaac
aagcgatcccgaacaaggacagattcctactctgccggccagtcagtagaaattttggac
ggtgtagagcttggggaaccagcccataagaaaacgggaactacagtaccagaatctatt
cattcttttattggagacggtttggtgaaaccagaggccctaaataagaaagccattcag
attattaacagggttcgagataagctcactggtcgggacttttctcatgatgaaactttg
gatgttccaatccaagtggagctgctcatcaaacaagcaacgtcccatgaaaacctctgc
cagtgctacattggatggtgtcctttctggtaa

DBGET integrated database retrieval system