KEGG   Trichechus manatus latirostris (Florida manatee): 101343879Help
Entry
101343879         CDS       T05135                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00512  Mucin type O-glycan biosynthesis
tmu01100  Metabolic pathways
Module
tmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101343879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tmu01003]
    101343879
Enzymes [BR:tmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101343879
Glycosyltransferases [BR:tmu01003]
 O-Glycan biosynthesis
  Mucin-type
   101343879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101343879
NCBI-ProteinID: XP_004380831
UniProt: A0A2Y9DTD6
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDDSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDISERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNAKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctcctggtgttgaacttgatcgcagtggccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccat
gagattcggccgcgcgctgaggcggccaaccttagcgcgcacagcgccagccccatccag
gatgccgtcctgaagcgcctttcgctgctcgaggacatcgtgtaccggcagctgaatggt
ttatccaaatcccttgggctcattgagggttatggtgggcgggggaaaggaggtcttcct
gctaccctttccccggctgaagaggaaaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgcaaggagctgaaatactccaaggacttgccgcagatctccattatattcatcttt
gtgaacgaggccctgtcggtgatcctgcggtcggtccacagtgctgtcaatcacacgcct
acacacctgctgaaggagattattctggtggatgacgacagtgacgaagaggagctgaag
gcccccttggaggagtacgtccacaaacgctaccccgggctggtgaaggtggtgcgtaat
cagaagagggagggcctgatccgggctcgcattgagggctggaaggcggccacgggccag
gtcactggcttcttcgatgcccacgtagaattcaccgctggctgggctgagccagttctg
tcccgaatccaggaaaaccgaaagcgagtgatccttccctccatcgacaacatcaaacag
gacaacttcgaggtgcagcggtacgagaactcggcccatgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggacgccggagacccttctctccccatc
aggacgccagccatgattggctgctccttcgtggtcaacaggaagttctttggtgaaatt
ggtcttcttgaccctgggatggatgtgtatggaggagaaaacatagaacttggaatcaag
gtgtggctctgcgggggcagcatggaggtcctgccgtgctcacgggtggcccatatcgag
cggaagaagaagccatacaacagcaacattggcttctacaccaagagaaatgctctccgg
gtggctgaggtctggatggacgattacaagtcccacgtgtacatagcatggaacctgccg
ctggagaatccaggaattgacatcggtgatatctctgaaagaagagcattaaggaaaagc
ttaaagtgtaagaattttcagtggtacctggaccacgtctacccagaaatgagaagatac
aacaatactgttgcgtatggggagcttcgcaacaacaaggcaaaagatgtctgcttggac
caggggccgctggagaaccacacagcaatactgtacccgtgccacggctgggggccgcag
ctggcccgctataccaaggaaggcttcctgcacctgggagcactggggaccaccacactg
ctccctgacacccgctgcctggtggacaacgccaagagtcggctcccccagcttctcgac
tgtgacaaggtcaagagcagcctgtacaaacgctggaacttcatccagaacggagccatc
atgaacaaggggacaggacgctgcctggaggtggagaaccgcggcctggcgggcatcgac
ctcatccttcgcagctgcacaggacagaggtggacgattaagaactccattaagtag

DBGET integrated database retrieval system