KEGG   Trichechus manatus latirostris (Florida manatee): 101344094Help
Entry
101344094         CDS       T05135                                 

Definition
(RefSeq) alpha-1B adrenergic receptor
  KO
K04136  adrenergic receptor alpha-1B
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04020  Calcium signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04080  Neuroactive ligand-receptor interaction
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04270  Vascular smooth muscle contraction
tmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101344094
   04022 cGMP-PKG signaling pathway
    101344094
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101344094
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101344094
   04270 Vascular smooth muscle contraction
    101344094
  09154 Digestive system
   04970 Salivary secretion
    101344094
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tmu04030]
    101344094
G protein-coupled receptors [BR:tmu04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    101344094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv Shisa
Motif
Other DBs
NCBI-GeneID: 101344094
NCBI-ProteinID: XP_004371304
UniProt: A0A2Y9DB42
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MNPNLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNIVVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAVLALLSVWGLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRGRRRRRRRRRLGGCAYTYRPWTRGCSLERSQSRKDSLDDSGSCLSGSQRTLP
SASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDLGPLFTFKLLAEP
ESPGTDRGASSVGCHAAADVANGQPGFKTNMPLAPGQF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaatctggacaccggccacaatacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctcaagcaactccacactgccccagctg
gacatcaccagggccatctctgtgggcctggtgctgggcgccttcatcctctttgccatc
gtgggcaacattgtcgtcatcttgtctgtggcctgtaaccgtcacctccggacgcccacc
aactacttcatcgtcaacctggcgattgccgacctgctgttaagcttcaccgtccttccc
ttctcagctgccctggaggttctaggatattgggtgttggggcggatcttctgtgacatc
tgggcggccgtggacgtcctgtgctgcacagcatccattctgagcctgtgcgccatctct
atcgatcgctacattggggtgcgctactctctgcagtacccaactctggtcacccgcagg
aaggccgtcttggcactcctgagtgtctgggggttgtctacggtcatctccattgggcct
ctccttgggtggaaggagccagcgcccaacgatgacaaggaatgcggagtgactgaagaa
cccttctatgccctcttctcctccctaggttccttctacatccctctggcggtcattctg
gtcatgtactgccgggtctacatcgttgctaagaggaccaccaagaacctggaggctgga
gtcatgaaggagatgtccaactccaaggagctgaccctgaggattcactccaagaacttt
cacgaggacacccttagcagtaccaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaaattctccagggaaaagaaagcagccaagaccttgggcattgtggtc
ggtatgttcatcttgtgttggctacccttcttcatcgctctaccacttggctccctgttc
tccaccctgaagccccctgacgccgtgttcaaggtggtgttctggctgggctacttcaac
agctgcctcaaccccatcatctacccgtgctccagcaaggagttcaagcgcgccttcatg
cgcatcctcggctgccagtgtcgcggtcgtcgccgccgccgccgccgccgtcgcctgggc
ggctgcgcctacacctaccggccgtggacgcgcggctgctcgctggagcgctcgcagtcg
cgcaaggactctctggacgacagcggcagttgcctgagcggcagccagcggaccctaccc
tcggcctcgccgagccccggctacctgggccgcggcgcgccgccgccggtcgagctgtgc
gccttccccgagtggaaggcgcccggcgccctgctgagcctgcccgcgccggagcccccc
ggccgtcgcggccgccacgacttgggcccgctcttcaccttcaagctcctggccgagccc
gagagccccgggaccgaccggggagccagcagtgtgggctgccatgcagcggccgacgtg
gccaacgggcaaccgggcttcaaaaccaacatgcccctggcgcccgggcagttttag

DBGET integrated database retrieval system