KEGG   Trichechus manatus latirostris (Florida manatee): 101344141Help
Entry
101344141         CDS       T05135                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03030  DNA replication
tmu03410  Base excision repair
tmu03420  Nucleotide excision repair
tmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101344141
   03410 Base excision repair
    101344141
   03420 Nucleotide excision repair
    101344141
   03430 Mismatch repair
    101344141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tmu03032]
    101344141
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101344141
Enzymes [BR:tmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101344141
    6.5.1.6  DNA ligase (ATP or NAD+)
     101344141
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101344141
DNA replication proteins [BR:tmu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101344141
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101344141
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101344141
   NER (nucleotide excision repair)
    Other NER factors
     101344141
   MMR (mismatch excision repair)
    Other MMR factors
     101344141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR DUF1682
Motif
Other DBs
NCBI-GeneID: 101344141
NCBI-ProteinID: XP_012412586
UniProt: A0A2Y9FYE1
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MQRSIMSFFQPKKEGKAKKPEKETSNSSRETEPPLKVALKEQNGVVPESESPVKRPARKA
ARVLGSEEEEEDSAPTSLKGQKPAPDSPRSSPPSPAASPESIPSLSDACPMEISPSGIPK
RRTARKQVPKRKIQDALEEQSEDKERETKRKKEEEEAETPAESITEPEVAKKKEAEDGDK
PTMSPEPLKMSKTETPAESVSEPAVAVKKEPQDGDQTKPPPRPPKMISSFFTPRKPATKK
EVKEEGSDAPGEEETKGPLDPAHYNPAKNNYHPVEDACWKSGQKVPYLAVARTFEKIEEV
SARLRMVETLSNLLRSVVALSPPDLLPVLYLSLSRLGPPQQGLELGVGDGVLLKAVAQAT
GRQLESVRAEAAEKGDVGLVAESSRTTQRIMLPPPPLTASGVFAKFRDIARLAGSASTAK
KIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALAQAVSLTPPSQEFPLAIVD
AGKGKTAEARKTWLDEQGIILKQTFCEVPDLDRIVPVLLEHGLEHLPEHCRLSPGIPLKP
MLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDII
DRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKDVDASEIQVQVCLYAFDL
IYLNGESLVREPLSRRRQLLWENFVETEGEFVFATSLDTKDTDQIAEFLEQSVRDSCEGL
MVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAS
YDKESEELQAICKLGTGFSDEELEKHHQSLQPLVLPSPRSYVRADGAVAPDHWLEPSTVW
EVKCADLSLSPIYPAARGLVDREKGISLRFPRFIRVREDKKPEEATTSAQVAQLYQAQSQ
IQNQKGASSESDLEDFY
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaacccaagaaggagggcaaagcaaagaagcca
gagaaggagacctccaacagtagcagagagacagagcctcccctgaaggtggcgctgaag
gagcagaatggagtagtgcccgagagtgagtctccagtgaagaggccggcgaggaaggca
gcccgggtcctgggcagcgaagaggaggaggaggacagtgcccccacctccctcaaaggc
cagaaacctgccccagattccccgcgatcctcccctcccagtcctgccgcatctccagag
agcatcccttccctttccgacgcctgtcccatggaaatctccccgtcagggatcccgaag
cgtcgcacagctcggaagcaggtcccgaaacggaaaattcaggatgccctggaagaacag
agtgaagacaaggaaagagagaccaagaggaagaaggaagaagaagaagcagagacccca
gcagaaagcatcacagagcctgaagtggcaaaaaagaaggaagcagaagacggggacaag
cccacgatgtcccctgaacccctcaagatgtccaaaacagagaccccggcagaaagcgtt
tcagagcctgcggtggccgtgaagaaggagccacaggatggggaccagaccaagcctccc
cccaggcctcccaagatgatcagcagtttcttcacccctcgaaagccagccaccaaaaaa
gaagtgaaagaagagggatcagacgctccgggagaagaggagaccaaggggcccctggac
ccagcgcactacaatcctgccaagaacaactaccaccctgtcgaagatgcctgctggaag
tccggccagaaggtcccctatctggctgtggcccggacctttgagaagatcgaggaggtt
tctgctcggctccggatggtggagacactgagcaacctgctgcgctctgtggtggccttg
tcacctccagacctcctccctgtcctctaccttagcctcagccgccttgggccaccccag
cagggcctggagctcggcgttggtgacggcgtccttctcaaagcagtggcccaggccaca
ggtcggcagctggagtccgtccgggctgaggcagccgagaagggcgatgtggggctggtg
gccgagagcagccgcaccactcagaggatcatgttgccccctcccccactcactgcttct
ggggtctttgccaagttccgtgacatcgcccggctggccggcagtgcttccacagccaag
aagatagacatcatcaaaggcctctttgttgcctgccgccactcagaagcccgattcatt
gcccggtccctgagtggacggctgcgtctcgggctggctgagcagtcagtcctggctgcc
ctcgcccaggctgtgagcctcacaccccccagccaagaattccccctggccatagtggat
gccgggaagggcaagacagcagaggccaggaaaacgtggctggacgagcaaggcatcatc
ctgaagcagacattctgtgaggtgcccgacctggaccgcatcgtgccggtgctgctggag
cacggcctggagcatctgccggagcactgccggctgagcccagggatccccctgaaacca
atgttggcccatcccacccggggtgtcagcgaagtcctcaagcgcttcgaggaggcagct
ttcacctgtgaatacaaatacgacgggcagagggcacagatccatgtcctggaaggcggg
gaggtgaagatcttcagccggaatcaggaagacaatactgggaagtaccccgacatcatc
gaccgcatccccaagatcaaactcccgtcagtcacctccttcatcctggacactgaggcc
gtggcttgggaccgggaaaagaagcaaatccagccattccaagtgcttaccacccgcaaa
cgcaaggatgtggacgcatcggagatccaggtgcaagtgtgtttgtacgcctttgacctc
atctacctcaacggagagtccctggtacgagagcccctttcccgacgccggcagctgctc
tgggagaactttgtggagacagagggcgagtttgtctttgccacctccctggacaccaag
gacactgaccagatcgccgagttcttggaacagtcggtgagagactcgtgtgaggggctg
atggtgaaaaccttggatgtggacgccacctacgagatcgccaagaggtcgcacaactgg
ctcaagctgaagaaggactacctcgagggagtgggcgacaccctggacctcgtggtcatc
ggcgcctacctgggccgcgggaagcgtgctggccgctatgggggcttcctcctggcctcc
tacgacaaggagagtgaggagctgcaagccatatgcaagctcggaacgggcttcagtgat
gaggagctggagaaacatcaccagagcctccagcccctggtgctgcccagcccacgctcc
tacgtgcgggccgacggggccgtggcccccgaccactggctggagcccagcaccgtgtgg
gaggtgaagtgtgccgacctgtccctctcccccatctaccccgcggcccgcggcctggtg
gaccgtgagaagggcatttcccttcgcttccctcggtttattcgcgttcgtgaggacaag
aagccggaggaagccaccaccagtgcccaggtggcacagctgtaccaggcgcaaagtcag
atccagaaccagaaaggtgcaagctcagaatctgacctggaggatttctactaa

DBGET integrated database retrieval system