KEGG   Trichechus manatus latirostris (Florida manatee): 101344245Help
Entry
101344245         CDS       T05135                                 

Definition
(RefSeq) histone deacetylase 7 isoform X2
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05034  Alcoholism
tmu05165  Human papillomavirus infection
tmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    101344245
  09165 Substance dependence
   05034 Alcoholism
    101344245
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    101344245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101344245
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101344245
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101344245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101344245
NCBI-ProteinID: XP_004384602
UniProt: A0A2Y9DZY3
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MDLRVGQRPPVEPTPEPTLLALQHSQRLHHHLFLAGLQQQQQQQQQRSAEPLRLSMDTPM
PELQVGQQEQELRQLLNKDKSKRSAIASSVVKQKLAEVILKKQQAALERTVHPSSPSIPY
RTLESLETERATRTMFSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKN
PLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPVLGSEADGDRRTH
PTLGPRGPVLGSPHAPLFLPPGLEPEVGGTLPSRLQPILLLDPSVSHAPLLTVPGLGPLP
FHLAQSLLTTERLSGSGLHRPLSRTRSEPLPPSTTAPPPLGPLQPRLERLKPHVQLIKRP
AKPSEKPRLRQIPSSEDLETDGGSVGQVGDNSLEHRESSHGQPEARGPFSLQQHQQVFLW
EQQQQQRLVGRLPRGGPGDSVLLPLAQGGHRPLSRAQSSPAAPASLPAPEPISQAHVLPS
SETPARTLPFTTGLFYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLR
GRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTI
WNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADRSTAMGFCFFNSVAIA
CRQLQQQGKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAADEVG
AGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPP
PLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLS
EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDAWVPRVPGADPEEVEAVAALAS
LSVGILAEERPSEQLVEEEEPMNL
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcgggtgggccagcggcccccggtggagcccaccccggagcccacgctgcta
gccctgcaacattcccagcgcctgcaccatcacctcttcctagcaggcttgcagcagcag
cagcagcagcagcaacagcgctcagcagagcccctgaggctctcaatggacacgccgatg
cctgagttgcaggtggggcagcaggagcaagaactgcgtcagcttctcaacaaggacaag
agcaagcggagtgccatagccagcagtgtggttaagcagaagctggcagaggtgattctg
aagaaacagcaggccgccctagagagaacagtccatcccagtagccccagcattccctac
agaactctcgagtccttggagactgaaagagccacccgcaccatgttcagcagtttcctg
cctcctgttcccagcctgcccagcgaccccccagagcacttccccctgcgtaagacagtc
tctgagcccaacctgaagctgcgctacaagcccaagaagtccctggagcggaggaagaat
ccgctgctgcggaaggagagtgccccgcccagtctgcgaaggcggccggcggagaccctc
ggtgactcatcccccagtagcagcagcacgcccgcatcagggtgcagctcccccaacgac
agtgagcatggccccaaccccgtcctgggctccgaggctgatggggaccgcaggactcat
ccaactctgggtcctcgggggccggtcctggggagcccccatgctcccctcttcctgccc
cctggcctggagcctgaagttgggggcaccttgccctctcgcctgcagcccattctcctc
ctggacccctcagtctctcatgccccgctgctgactgtgcccgggcttgggcctctgccc
ttccacttggcccagtccttactgaccaccgagcggctctccgggtcgggtctccaccgg
ccactgagccggacccgctcagagcccctgccccccagcaccaccgcccccccaccgctg
ggccccctgcagcctcgtctggagcggctcaaacctcacgtccagctgatcaagaggcca
gccaagccaagtgagaagccccggctacggcagataccctcatctgaggacctagagaca
gatggtggcagcgtggggcaggtgggcgacaacagcctggaacacagggagtcgagccac
gggcagccagaggccagaggccccttttctcttcagcagcaccagcaggtgttcctctgg
gagcagcagcagcagcagcgactggtggggcggctcccccggggaggccctggggactct
gtgctgcttcccctggcccagggcggacaccggcctctgtccagggctcagtcttcccca
gctgcgcctgcctcactgccagccccagaacccattagccaggctcatgtccttcccagc
tctgagacccctgccaggaccctgccattcaccacagggctgttctatgactcagtaatg
ctgaagcaccagtgctcctgtggagacaacagcaggcacccggagcatgctggccgcatc
cagagtatctggtcccgactgcaggagcgggggctccggagccagtgtgagtgtctccgg
ggccggaaggcctccttggaggagctgcagtcagtccactccgagaggcacgtgctcctc
tacggtaccaacccgcttagtcgcctcaaactggacaacgggaagctggcagggctcctg
gcacagcggatgtttgtgatgctgccctgtggtggggttggggtggacactgacaccatc
tggaatgagctgcactcctctaatgcagcccgctgggctgcgggcagcgtcacggacctc
gccttcaaagtagcttcccgtgaactaaagaatggttttgctgtggtacggcccccagga
caccatgcagaccgttccacagccatgggcttctgcttcttcaactcagtggccatagcc
tgccggcagctgcaacaacagggcaaggccagcaagatccttattgtggactgggacgtt
caccatggcaatggcacccagcagaccttctaccaggaccccagtgtgctctacatctcc
ctgcatcgccatgatgatggcaacttcttcccaggcagtggggccgctgatgaggtgggg
gctggcagtggtgagggcttcaatgtcaatgtggcctgggctggaggtctggaccccccc
atgggggaccctgaatacctggctgccttcaggatagtcgtgatgcccattgcgcgagag
ttctctccagacctggtcctggtgtcggctgggtttgatgctgccgagggtcacccgccc
ccactgggtggctaccatgtgtccgctaaatgttttgggtacatgacacagcagctgatg
aacttggcgggaggtgcagtggtgctggccttggagggtggccacgacctcaccgccatc
tgtgatgcttccgaggcctgtgtggctgctcttctgggcaacaaggtggatcccctctct
gaagagggctggaaacagaaacccaacctcaatgctatccgctccctggaagctgtgatc
cgggtgcacagtaaatactggggctgcatgcagcgcctggcctcctgcccagatgcctgg
gtgcccagggtgccaggggctgacccagaagaagtggaggcagtggctgcactggcatcg
ctctccgtgggcatcctggctgaagagaggccctcagagcagctggtggaggaagaagaa
cctatgaatctctga

DBGET integrated database retrieval system