KEGG   Trichechus manatus latirostris (Florida manatee): 101344321
Entry
101344321         CDS       T05135                                 

Definition
(RefSeq) dual specificity protein phosphatase 6 isoform X1
  KO
K21946  dual specificity phosphatase 6 [EC:3.1.3.16 3.1.3.48]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101344321
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101344321
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101344321
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101344321
    3.1.3.48  protein-tyrosine-phosphatase
     101344321
Protein phosphatases and associated proteins [BR:tmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    101344321
SSDB
Motif
Pfam: DSPc Rhodanese Y_phosphatase Init_tRNA_PT PTPlike_phytase
Other DBs
NCBI-GeneID: 101344321
NCBI-ProteinID: XP_004384245
UniProt: A0A2Y9E161
LinkDB
Position
Unknown
AA seq 380 aa
MIDTLRPVPFASEMAISKTVAWVNEQLELGNERLLLMDCRAQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFIRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSDIE
SDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTP
NLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSV
TVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPGQQ
LYFTTPSNQNVYQVDSLQST
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatagatacgctcagaccggtgcccttcgcgtcggaaatggcgatcagcaagacggtg
gcgtgggtcaatgagcagctggagctgggcaacgagcggttgcttctgatggactgccgg
gcgcaagagctgtacgagtcgtctcacatcgaatccgccatcaacgtggccatcccgggc
atcatgctgcggcgcctgcagaagggcaacctgccagtgcgcgcgctcttcacgcgcggc
gaggaccgggaccgctttatccggcgctgcggcaccgacaccgtggtgctctacgacgag
agtagcagcgactggaacgagaacacgggtggcgagtcggtgctcgggttactgcttaag
aagctcaaggacgagggctgtagggcgttctacctggaaggtggcttcagtaagttccaa
gctgagttcgccctgcactgcgagaccaatctagacggctcgtgtagcagcagctcgccg
cccttgccagtgctgggactcgggggtctgcggatcagctctgactcctccgacattgaa
tctgaccttgaccgagaccccaatagtgccacggactcggatggcagcccgctgtccaac
agtcagccttccttcccggtggagatcttgcccttcctctacctgggctgtgccaaggac
tccaccaacttggacgtgttggaggagttcggcatcaagtatatcttaaacgtcaccccc
aatttgccgaatctctttgagaacgcaggagagtttaaatacaaacagatccccatctcg
gatcactggagccaaaacctgtcccagtttttccctgaggccatttctttcatagatgaa
gcccggggcaaaaactgtggtgtcttggtgcattgcttggctggcattagccgctcggtc
actgtgactgtggcttaccttatgcagaagctcaatctgtcaatgaacgacgcttacgac
attgtcaagatgaagaaatccaacatctcccccaacttcaatttcatgggccagttgctg
gactttgagaggacactgggactgagcagcccctgtgacaaccgggttccggggcagcag
ctgtatttcaccactccttccaaccagaatgtctaccaggtggactccctgcaatccacg
tga

DBGET integrated database retrieval system