KEGG   Trichechus manatus latirostris (Florida manatee): 101344373Help
Entry
101344373         CDS       T05135                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00052  Galactose metabolism
tmu00500  Starch and sucrose metabolism
tmu01100  Metabolic pathways
tmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101344373
   00500 Starch and sucrose metabolism
    101344373
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101344373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101344373
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101344373
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101344373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101344373
NCBI-ProteinID: XP_012410418
UniProt: A0A2Y9FWA5
LinkDB All DBs
Position
Unknown
AA seq 1145 aa AA seqDB search
MEPEVLVEAGNGNGTERHGRACSSKKQPPRKRALPWGILEVAPLAGIRRSHAGAANTPPG
GARRPTSRPTGGAGCRSRAPAVTCLPVRDLSVAAGRGGAEGSLDCSARDLSLPWIHVPVS
RIPFPDEGKASSPLASRWPRPNRLGPSLYAEVTHHACSERLLLRSASIAQVSCHQILMHI
KRLCIHGFSAAQLTMGMGQLPCSRHLAWPLLGTCAFTLLATAALMAHILQRDFTVVPREW
SGLSQGLEEANQAHSRGPEHAPESRSRPGPVPTQCDVPPNSRFDCAPEAAITQEQCEARG
CCYIPAQHGAQGPRMGQPWCFFPPSYPSYRLENLTATQMGYTATLTRAAPTFFPKDILTL
RLEVLMETESRLHFTIKDPANKRYEVPLETPHVHSRTLAPLYSVEFSQEPFGVVVRRKLD
GRVLLNTTVAPLFFTDQFLQLSTTLPTPYVVGLAEHLSPLMLSTNWTKITLWNRDMAPEP
GVNLYGSHPFYLVLENGGSAHGVFLLNSNAMDVVLQPSPALSWRTTGGILDVYVFLGPEP
KSVVQQYLAVVGYPSMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRAGFPLDVQWNDLDY
MDARRDFTFNKDGFEDFPAMVQELHQGGRHYVMLVDPAISSTGPAGSYRPYDEGLRRGVF
IINATGQPLIGKVWPGASAFPDFTSPETQSWWQDMVAEFHSQVPFDGMWIDMNEPSNFVK
GSEVGCPDNELENPPYVPGVAGGTLRAATICASSRQHLSSHYDLHNLYGLTEAIASHRAL
VMARGTRPFVISRSTFASHGRYAGHWTGDVWSSWEQLALSVPATLLFNLLGVPLVGADIC
GFLGNTSEELCVRWTQLGAFYPFMRNHNSLDSLPQEPYRFSATAQEAMRKAFTLRYALLP
YLYTLFQRAHVSGETVARPLFLEFPQDPHTWTVDRQLLWGEALLITPVLEAGKTEVTGYL
PAGTWYNLQTVPMDALGSLPPPSPTPLKSVIHSQGQWVMLPAPLDTINLHLRGGYIIPLQ
GPSLTTTESRKQPMALVVALSSSGDAQGELFWDDGESLGVLEHGAYTLVIFLAKNNTVVN
KLVHVASEGAGLQLRKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKILDIPVSLFMGEQF
LISWS
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggaagttctggtggaggcgggaaatggtaatggcacggaacgtcatgggcgc
gcctgcagctccaagaagcagcctccccgcaagcgcgcgctcccttggggcatcctcgaa
gtcgccccgctggcgggaatcaggaggagccacgcgggggccgcaaacacgccaccaggg
ggcgctcggcggcccacatcccgccccaccggcggcgccggctgccggtcacgtgcccct
gccgtcacgtgcctgccagtgcgggacctgagtgtcgctgcaggccggggtggcgcggag
gggtcgctggactgtagtgcccgagacctctcgctgccctggatccacgtcccagtcagc
aggattcccttcccagatgaagggaaggcgtcatctccacttgcatcccgctggccacgc
ccaaatcgcctgggccccagtctctacgcagaggtgactcaccacgcctgttccgagagg
ctcttgttgcgctcagcgtctattgcgcaggtctcctgccatcagatcctaatgcacatt
aagcgcctctgcatccacggcttctctgctgcccagctgaccatgggcatggggcagctg
ccctgctccaggcacctggcctggcccctgctagggacatgcgccttcaccctcttggcc
acagctgccctcatggcgcacatcctgcagcgtgatttcaccgtggttccccgagagtgg
agcgggctctcccaaggactggaggaggctaaccaagctcacagccgggggcccgagcat
gccccggagagccgcagcaggcccgggccagtgcccacacagtgcgacgtgccccccaac
agccgcttcgactgcgcccccgaggcggccatcacccaggagcagtgcgaggcccgtggc
tgctgctacatccctgctcagcatggcgcccagggcccccgaatggggcagccctggtgc
ttttttccccctagctaccccagctacaggctggagaacctcaccgccacacagatgggc
tacacagccaccctgacccgcgccgcccccaccttcttccctaaggacatcctgaccctg
cggctggaggtgctgatggagaccgagagccgcctccacttcacgatcaaagacccagct
aacaagcgctatgaggtccccctggagaccccgcatgtgcatagccggaccctggccccg
ctttacagcgtggagttctcccaggagccctttggcgtggtcgtgcgccggaagctggac
ggccgggtgctgctgaacacgacagtggcgcctctgttcttcactgaccagtttctgcag
ctgtccaccaccctgcccaccccgtacgtggtgggccttgccgagcacctcagccccctg
atgctcagcaccaactggaccaagatcaccctctggaatcgggacatggcccccgagccc
ggcgtgaacctctacggctcccaccccttctacctggtgctggagaacgggggttcagcc
cacggggtattcctgctaaacagcaacgccatggacgtggtcctgcagccgagcccggcc
ctcagctggaggacaacaggtgggatcctggacgtgtacgtcttcctggggccggagccc
aagagcgtggtgcagcagtacctagcggtcgtggggtacccgtccatgccgccctactgg
ggcctgggcttccacctctgccgctggggctactcctccacagccattgtccgccaggtg
gtggagaacatgaccagggccggcttccccctggacgtccagtggaacgacctggactac
atggatgccagaagagactttaccttcaacaaggacggtttcgaggacttccccgccatg
gtgcaggagctccaccagggcggccggcactacgtcatgctggttgatcccgccatcagc
agcacgggccccgcggggagctacagaccttatgatgagggtctgaggaggggagtcttc
atcatcaacgccactgggcagccactgattgggaaggtgtggcccggagcctctgccttc
cctgacttcaccagccctgagacccagagctggtggcaggacatggtggccgagttccac
tcccaggtgcccttcgacggcatgtggattgacatgaatgagccgtccaactttgtaaag
ggctctgaggtcggttgccccgacaatgagctggagaacccgccatatgtgccaggcgtg
gcgggcgggaccctccgggcagccaccatctgtgcgtccagtcgccagcacctgtcttct
cactacgacctgcacaacctgtacgggctgaccgaggccatcgcctcccacagggccctg
gtgatggctcgggggacacgcccctttgtgatctcccgttcaacctttgccagccatggc
cgctatgccggccactggacgggggacgtctggagcagctgggagcagctcgccctgtcg
gtgcctgcaaccctgctcttcaacctgctgggcgtgcccctggtgggggctgacatctgc
ggcttcctgggcaacacctcagaggagctatgcgtgcgctggacccagctgggggccttc
tacccgttcatgcgtaaccacaacagcctcgacagcctgccccaggagccgtacaggttc
agtgcgacggcgcaggaagccatgaggaaggccttcaccctgcgctacgcgttgctgccc
tatctctacacgctgttccaaagggcccacgtcagcggcgagacggtggcgcggcccctc
ttcctggagttcccccaggacccccacacctggaccgtggaccgccagctgctgtggggg
gaggccctcctcatcaccccagtgctggaggccgggaagactgaggtgaccggctacctc
cccgcgggcacgtggtacaacctgcagacggtgccaatggacgccttgggcagcctccca
ccgccgtctcccacacccctcaagtcagtcattcacagtcagggacagtgggtgatgctg
ccagccccactggacaccatcaacctccatctgcggggcggctacatcatccccttgcag
ggcccgagcctcaccaccaccgagtcccgcaagcagcccatggcactggtggtggccctg
agctcaagcggggatgcccagggggagctgttctgggacgatggagagagcctgggggtg
ctggagcacggggcctacaccctggtcatcttcctggccaagaacaacaccgtcgtgaac
aagctggtgcacgtggccagtgagggggccggcttgcagctgaggaaggtgactgtcctg
ggtgtggccacagccccgcagcaggtcctctccaatggcgttcccgtctccaacttcacc
tacagccctgataccaagatcctggacatccctgtctctctcttcatgggagagcagttc
ctcatcagttggtcctga

DBGET integrated database retrieval system