KEGG   Trichechus manatus latirostris (Florida manatee): 101344479
Entry
101344479         CDS       T05135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: monocyte differentiation antigen CD14
  KO
K04391  monocyte differentiation antigen CD14
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04145  Phagosome
tmu04620  Toll-like receptor signaling pathway
tmu04640  Hematopoietic cell lineage
tmu05132  Salmonella infection
tmu05133  Pertussis
tmu05134  Legionellosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101344479
   04064 NF-kappa B signaling pathway
    101344479
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101344479
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101344479
   04620 Toll-like receptor signaling pathway
    101344479
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101344479
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101344479
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101344479
   05133 Pertussis
    101344479
   05134 Legionellosis
    101344479
   05152 Tuberculosis
    101344479
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101344479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101344479
   04090 CD molecules [BR:tmu04090]
    101344479
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tmu00537]
    101344479
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101344479
CD molecules [BR:tmu04090]
 Proteins
  101344479
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tmu00537]
 Receptors
  101344479
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6 Sortilin_C
Other DBs
NCBI-GeneID: 101344479
NCBI-ProteinID: XP_012412310
UniProt: A0A2Y9FYE5
LinkDB
Position
Unknown
AA seq 377 aa
MVSELSSCLLLLLLLPPQLAASEATPEPCELDDEDYHCACNFSDPQPDWSNGYQCMVAVE
VQIRGGGHSLETFLEVADTDPQKYADVIKALRVRRLTVGAARVPARLLFAVLRALGYSRL
KELTLEDLEVTGTYPPPPLEATGPALSTLRLRNVSWATGGAWLAELQKWLKPNLKVLSIA
QTHPLALSCEQFRTFPTLTTLDLSDNPGLGERGLAAALCPHKFPALQDLGLRNTGMETPN
GVCAVLAAAAVQPNRLDLSQNALRATANPGGPRCVWPSELSSLLLSFAGLEQVPKGLPAK
LSVLDLSCNRLNRAPRPDELPQVENLTLDGNPFLDAGVAKPHEGPKNSGATGVCGHSTLT
XGMSGSLALLQGARGFT
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggtgagtgagctctcatcttgcctgttgctgctgttgctgctgccgccgcagctggcc
gcttcggaggccacgccggagccgtgcgagctggacgatgaagattaccactgcgcctgc
aacttctcggatccacagcccgactggtccaatggctaccaatgtatggttgccgtcgag
gtgcagattcgtggtggcggccacagtcttgagacttttttagaggtcgctgataccgac
ccgcagaaatacgctgatgtgataaaggctctgcgcgtgcggcggctcaccgtgggcgct
gcccgggttcctgcccggctcctgttcgcagtccttcgtgcgctcggttactcccgcctc
aaggaactgacgctggaggacctggaggtaaccggcacctatccgccgccgcctctggaa
gccacagggcctgcgctctccaccctccgcctgcgcaacgtgtcgtgggccacggggggt
gcctggctggccgaactgcaaaagtggctcaagccaaacctcaaggtactgagcattgcg
caaacacacccgcttgctttatcttgcgagcagttccgcaccttcccgactctcaccacc
ctagacttgtcggacaaccctggactgggcgagcgcgggctggctgcggccctctgtcct
cacaagttccccgccctccaggatctggggctgcgcaacacagggatggagactcccaac
ggcgtgtgtgcggtgctggcggcggctgctgtgcagcctaaccgcctagacctcagccag
aacgcgctgcgcgccaccgcaaaccccggcggccctaggtgcgtctggcccagcgaattg
agctccctcctcttgtcgttcgctggactggagcaggtgcctaagggactgccggccaag
ctcagcgtgctggatctcagctgcaaccggctgaacagggcgccgcggccagatgaactg
ccccaggtggaaaacctgacactggacgggaatcccttcctggacgctggagtcgccaag
ccccacgagggcccgaagaactcaggtgcaactggagtctgtgggcactcgaccctgaca
ntagggatgtcaggcagcctggcgttgctccaaggggcccgaggcttcacctaa

KEGG   Trichechus manatus latirostris (Florida manatee): 101344727
Entry
101344727         CDS       T05135                                 

Definition
(RefSeq) monocyte differentiation antigen CD14
  KO
K04391  monocyte differentiation antigen CD14
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04145  Phagosome
tmu04620  Toll-like receptor signaling pathway
tmu04640  Hematopoietic cell lineage
tmu05132  Salmonella infection
tmu05133  Pertussis
tmu05134  Legionellosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101344727
   04064 NF-kappa B signaling pathway
    101344727
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101344727
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101344727
   04620 Toll-like receptor signaling pathway
    101344727
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101344727
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101344727
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101344727
   05133 Pertussis
    101344727
   05134 Legionellosis
    101344727
   05152 Tuberculosis
    101344727
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101344727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101344727
   04090 CD molecules [BR:tmu04090]
    101344727
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tmu00537]
    101344727
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101344727
CD molecules [BR:tmu04090]
 Proteins
  101344727
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tmu00537]
 Receptors
  101344727
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6 Sortilin_C
Other DBs
NCBI-GeneID: 101344727
NCBI-ProteinID: XP_023591381
UniProt: A0A2Y9RD10
LinkDB
Position
Unknown
AA seq 375 aa
MELSPSLLLLLLLPPQLAASEATPEPCELDDEDYRCACNFTDPQPDWSSGIQCMVAVEVE
IRAGGHSLDKYLKHADPDSQQYADMIKALRLRRLTVGAARVPARLLFAVLRALGYSRLKE
LTLEDLEVTGTYPPPPLEATGPALSTLRLRNVSWATGGAWLAELQKWLKPNLKVLSIAQT
HPLALSCEQFRTFPTLTTLDLSDNPGLGERGLAAALCPHKFPALQDLGLRNTGMETPNGV
CAVLAAAAVQPHRLDLSQNALRATANPGGPRCVWPSTLSSLNLSFAGLEQVPNGLPAKLS
VLDLSCNRLIRAPRPDELPQMENLILDGNPFRDLGDPKPQQDTMNSSVPLACVHSLLAIG
ISGTLALLQGVRGFV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggagctctcgcccagcctgttgctgctgttgctgctgccgccgcagctggccgcttcg
gaggccacgccggagccgtgcgagctggacgatgaagattaccgttgcgcctgcaacttc
acggatccgcagcctgactggtccagtggaatccagtgtatggttgccgtcgaggtggag
atccgtgccggtggacacagcctggacaagtatctaaagcacgcggatcctgactcgcag
cagtacgctgacatgataaaggctctgcgcttgcggcggctcaccgtgggcgctgcccgg
gttcctgcccggctcctgttcgcagtccttcgtgcgctcggttactcccgcctcaaggaa
ctgacgctggaggacctggaggtaaccggcacctatccgccgccgcctctggaagccaca
gggcctgcgctctccaccctccgcctgcgcaacgtgtcgtgggccacggggggtgcctgg
ctggccgaactgcaaaagtggctcaagccaaacctcaaggtactgagcattgcgcaaaca
cacccgcttgctttatcttgcgagcagttccgcaccttcccgactctcaccaccctagac
ttgtcggacaaccctggactgggcgagcgcgggctggctgcggccctctgtcctcacaag
ttccccgccctccaggatctggggctgcgcaacacagggatggagactcccaacggcgtg
tgtgcggtgctggcggcggctgctgtgcagcctcaccgcctagacctcagccagaacgcg
ctgcgcgccaccgcaaaccccggcggccctaggtgcgtctggcccagcacattgagctct
ctcaacctgtcattcgctggactggagcaggtacctaacggactgccggccaagctcagc
gtgctggatctcagctgcaaccggctgatcagggcgccgcggccagatgaactgccccag
atggaaaacctgatactggacgggaatcccttccgggaccttggagaccccaaaccccag
caggatacaatgaactctagtgtgcccctagcctgtgtgcactcgctcctggccatagga
atatcaggaaccttggcactgctccaaggggtcaggggcttcgtctag

DBGET integrated database retrieval system