KEGG   Trichechus manatus latirostris (Florida manatee): 101344569Help
Entry
101344569         CDS       T05135                                 

Definition
(RefSeq) microsomal glutathione S-transferase 2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00480  Glutathione metabolism
tmu00980  Metabolism of xenobiotics by cytochrome P450
tmu00982  Drug metabolism - cytochrome P450
tmu00983  Drug metabolism - other enzymes
tmu01524  Platinum drug resistance
tmu05200  Pathways in cancer
tmu05204  Chemical carcinogenesis
tmu05225  Hepatocellular carcinoma
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101344569
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101344569
   00982 Drug metabolism - cytochrome P450
    101344569
   00983 Drug metabolism - other enzymes
    101344569
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101344569
   05204 Chemical carcinogenesis
    101344569
   05225 Hepatocellular carcinoma
    101344569
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101344569
  Drug resistance
   01524 Platinum drug resistance
    101344569
Enzymes [BR:tmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101344569
Transporters [BR:tmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   101344569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 101344569
NCBI-ProteinID: XP_023595506
LinkDB All DBs
Position
Unknown
AA seq 147 aa AA seqDB search
MTGNSILLAAVSVLSACQQSYFAFQVGRARLKYKVTPPAVTGSPDFERVFRAQQNCVEFY
PVFLVAFWMAGWYFNEVFATFLGLVYIYARHQYFCGYSEAAKNRISGFRLSLGILAALTV
LGSLGIANSFLDEYLDLNIAKKLKWHL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgactgggaattcaatcctgctggctgctgtgtctgttctctctgcttgtcagcaaagt
tattttgcttttcaggtcggaagggcaagattaaaatacaaagtcacacccccagcagtt
accgggtcaccagactttgagagagtatttcgtgcacaacaaaactgtgtggagttttat
cctgtatttttggttgcattctggatggctgggtggtatttcaacgaagtttttgcaacc
tttctgggtctggtgtacatttatgcccgtcaccagtacttctgtggatattcagaagct
gctaaaaacaggatctctggtttccgcttgagtctggggattttggctgcattgactgtc
ctaggcagcttgggcattgcaaacagctttctggatgaatacctggacctcaatattgcc
aagaaactgaagtggcacctctaa

DBGET integrated database retrieval system