KEGG   Trichechus manatus latirostris (Florida manatee): 101344839
Entry
101344839         CDS       T05135                                 

Definition
(RefSeq) CCAAT/enhancer-binding protein alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04932  Non-alcoholic fatty liver disease
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101344839
   05202 Transcriptional misregulation in cancer
    101344839
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101344839
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101344839
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101344839
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    101344839
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin TolA_bind_tri bZIP_Maf GAS Lipoprotein_20 Hema_stalk DivIC DUF2514
Other DBs
NCBI-GeneID: 101344839
NCBI-ProteinID: XP_004371667
UniProt: A0A2Y9DC80
LinkDB
Position
Unknown
AA seq 352 aa
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPQGAGPAQPLPPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGGGSDFDYPGAPAGSGGSVMPG
GAHGPLPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPHPHPPSAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAG
LPGPGGTLKGLAAAHPDLRGSGGGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQR
NVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggagtcagccgacttctacgaggcggagccgcggcccccgatgagcagccacctccag
agccccccgcacgcgcccagcagcgccgccttcggctttccccaaggcgcgggccccgcg
cagcctctccccccacctgccgccccggagccgctgggcggcatctgcgaacacgagacg
tctatcgacatcagtgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctgttccagcacagccggcagcaggagaaggccaaggcagccgcggcccccgcgggcggc
ggcagcgacttcgactaccccggcgccccggcgggctccggcggctctgtcatgcccggc
ggggcgcacggcccccttcctggctacggctgcgcggcggccggctacctggacggcagg
ctggaacctctgtacgagcgcgtcggggcgccggcgctgcggccgctggtgatcaagcag
gagccgcgcgaggaggacgaggcgaagcagctggcgctggccggcctcttcccctaccag
ccgccgccgccgccgccgccgcacccgcacccgccgtccgcgcacctggccgccccgcac
ctgcagttccagatcgcgcactgcggccagaccaccatgcacctgcagcctggccacccc
acgccgccacctacacccgtgcccagcccgcacccagcgcctgcgcttggcgccgccggc
ctgccaggcccaggcggcacgctcaaggggctggcggccgcgcacccagaccttcgcggg
agcggcggcggcgcgggcaaggcgaagaagtcggtagacaagaacagcaacgaatacagg
gttcggcgcgagcgcaacaacatcgcggtgcgcaagagccgcgacaaggccaagcagcgc
aacgtggagacgcagcagaaggtgctggagctgaccagtgacaatgaccgcctgcgcaag
cgggtggaacagctgagtcgcgaactggacacgctgcggggcatcttccgccagctgcct
gaaagctccctggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system