KEGG   Trichechus manatus latirostris (Florida manatee): 101345018Help
Entry
101345018         CDS       T05135                                 

Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00590  Arachidonic acid metabolism
tmu01100  Metabolic pathways
tmu04064  NF-kappa B signaling pathway
tmu04370  VEGF signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04657  IL-17 signaling pathway
tmu04668  TNF signaling pathway
tmu04723  Retrograde endocannabinoid signaling
tmu04726  Serotonergic synapse
tmu04913  Ovarian steroidogenesis
tmu04921  Oxytocin signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu05140  Leishmaniasis
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05200  Pathways in cancer
tmu05204  Chemical carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101345018
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101345018
   04064 NF-kappa B signaling pathway
    101345018
   04668 TNF signaling pathway
    101345018
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101345018
   04657 IL-17 signaling pathway
    101345018
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101345018
   04913 Ovarian steroidogenesis
    101345018
   04921 Oxytocin signaling pathway
    101345018
  09156 Nervous system
   04726 Serotonergic synapse
    101345018
   04723 Retrograde endocannabinoid signaling
    101345018
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101345018
   05206 MicroRNAs in cancer
    101345018
   05204 Chemical carcinogenesis
    101345018
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    101345018
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    101345018
   05167 Kaposi sarcoma-associated herpesvirus infection
    101345018
   05165 Human papillomavirus infection
    101345018
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    101345018
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101345018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101345018
NCBI-ProteinID: XP_004372982
UniProt: A0A2Y9DE95
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MLVRVLLLCAVLALSHSANPCCSNPCQNRGVCMTTGFDQYKCDCTRTGFYGENCSIPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNSPFLRNAIMKYVLTSRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVPHDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEVYPPTVKDTQAEMIYPPHVPEHLRFAVGHEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFNKEFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDNQEYNYQQFIYNNSILLEHGLTHFVESFTRQIAGRV
AGGRNVAPAVQKVAQASIDQSREMKYQSLNEYRKRFMMRPYTSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPHYWKPSTFGGEV
GFNIINTASIQSLICSNVKGCPYTAFSVPDPQLTKAIVINASSSHSRLDDMNPAVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtccgcgtgctgcttctttgcgcggtcctggcgctcagccactcagcaaatcct
tgctgttccaacccgtgtcaaaaccgaggtgtatgcatgaccacaggatttgatcagtat
aaatgtgattgcactcgtacaggattctatggtgaaaactgttcaatacctgaatttctg
acaagaataaaattattactgaaacccactcccaacaccgtgcactacatacttacccac
ttcaagggagtttggaacattgtcaataatagtccctttctgcgaaatgccattatgaaa
tatgtgttgacatcaagatcacatttgattgacagcccaccaacttataatgttcactat
ggctataaaagctgggaagccttttccaacctctcctattacaccagagcccttcctccc
gtacctcatgactgtcctacgcccatgggtgtgaaaggaaagaaagaacttcctgattcg
aaagagattgtggagaaatttcttctgagaagaaagttcattcctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccagctttcaccaaaggattgggccatggggtggatttaaatcatatttac
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataatcgatggagaggtttatcctcctaccgtcaaagatactcaggcagagatgatc
tacccgcctcatgtccctgagcacctgcggtttgctgtgggccacgaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatttggcttcgggagcataacagagtgtgcgat
gtgcttaaacaggagcatccagagtgggatgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagactatgtgcagcacttgagcggc
tataacttcaaactgaagtttgacccagagcttctttttaacaaagaattccagtaccaa
aaccgtattgctgctgaatttaacacactctaccactggcatcctcttctgcctgacacc
tttcaaattgataaccaggagtacaactatcaacagtttatctacaacaactctatatta
ctggaacatggacttactcactttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggcaggaatgttgcacctgcagtacaaaaagtagcacaggcatctattgatcag
agcagagagatgaaataccagtctctcaatgagtaccgcaaacgctttatgatgagaccc
tatacgtcatttgaagaacttactggagagaaggaaatggctgcagagttagaggcactc
tatggtgacattgatgctatggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgctatctttggtgagaccatggtagaacttggagcaccattctccttgaaaggactc
atgggtaatcctatatgttctcctcactactggaagcctagcacctttggtggagaagta
ggttttaacatcatcaacacagcctcaatccagtctctcatctgcagtaatgtgaagggc
tgtccctatactgcgttcagtgttccagatccacagctcaccaaagcaatcgtcattaat
gcaagctcttcccactccagactagatgatatgaaccccgcagtcctgctaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system