KEGG   Trichechus manatus latirostris (Florida manatee): 101345412Help
Entry
101345412         CDS       T05135                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04068  FoxO signaling pathway
tmu04146  Peroxisome
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101345412
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101345412
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    101345412
   04213 Longevity regulating pathway - multiple species
    101345412
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    101345412
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101345412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101345412
NCBI-ProteinID: XP_023584445
UniProt: A0A2Y9QLW7
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MLCRAACSTSRKLVPALGALGSRQKHSLPDLPYDYGALEPYINAQIMQLHHNKHHAAYVN
NLNIAEEKYKEALAKDDVTTQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IVRDFGSFEKFTKKLTAVCVGVQGSGWGWLGFNKERGLLQIAACSNQDPLEGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWKVINWDNVTARYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgtgcagcacgagcaggaagctggtaccagctttgggagctttg
ggctccagacagaagcacagcctgcctgacttgccgtatgattatggcgccctggagccg
tacattaacgctcaaatcatgcagctgcaccacaacaaacaccacgccgcttacgtgaac
aacttaaacatcgctgaggagaagtataaagaggcgctggcaaaggatgatgttacaacc
cagatagctctccagcctgcgctgaagttcaatggcggaggtcacattaatcatagcatc
ttctggacaaacctgagccctaatggcggtggagaacccaaaggggaattgctggaggcc
atcgtacgtgactttggttcctttgagaagtttacgaagaagttgacagctgtgtgtgtt
ggcgttcagggttcaggctggggttggcttggtttcaacaaggaacggggactcttacag
attgccgcttgttctaatcaggacccactggaaggaacaacaggtcttattccactgctg
gggattgatgtgtgggagcatgcttattaccttcagtataaaaatgtcagacctgattac
ttaaaagctatttggaaggtgatcaactgggacaacgtaactgcaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system