KEGG   Trichechus manatus latirostris (Florida manatee): 101345626
Entry
101345626         CDS       T05135                                 

Definition
(RefSeq) serine/threonine-protein kinase pim-2 isoform X1
  KO
K08806  proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05200  Pathways in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101345626
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101345626
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101345626
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101345626
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   101345626
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal RIO1 Choline_kinase
Other DBs
NCBI-GeneID: 101345626
NCBI-ProteinID: XP_004376916
UniProt: A0A2Y9DLI8
LinkDB
Position
Unknown
AA seq 311 aa
MLTKPLQGLPAPPVTSMPPPGGKNREAFEAEYRLGPLLGKGGFGTVFAGHRVADRLQVAI
KVIPRNRVLGWFPSTDSAACPLEVALLWKVGAGGGHPGVIRLLDWFETPEGVMLVLERPL
PAQDLFDYITEQGPLGEGRSRCLFAQVVAAVRHCHACGVVHRDIKDENILMDLRRGCVKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPDHVSPDCCALIRRCLAPKPSARPSLEEILLDPWMQTPAEDAPLSTPKG
DPTPLAWSLLP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttgaccaaacctctgcaggggcttcccgcgccccccgtgacctccatgccgccccca
ggaggcaagaatcgggaagcttttgaggccgagtaccgactcggccccctcctgggcaag
gggggcttcggcactgtcttcgcgggacaccgtgtcgcagaccgactccaggtggccatc
aaagtgatcccccggaatcgtgtgctgggctggttcccctcgacagactcagccgcatgc
ccactcgaggtggcactgctatggaaggtgggtgcaggtggtgggcaccctggtgtgatt
cgcctgcttgactggtttgagacaccagagggcgtcatgctggtcctcgagcggcctttg
cctgcccaggatctctttgactacatcacagagcagggcccactgggtgagggccgaagc
cgctgcctctttgcccaggtagtggcagccgttcggcactgccatgcctgtggagttgtc
caccgtgacatcaaggacgaaaacatcctgatggacctccgccggggctgtgtcaaactc
attgattttgggtccggtgccctgcttcatgatgaaccctacactgactttgatgggaca
agggtgtacagccccccagagtggatctctcgacaccagtaccatgcactcccggccact
gtctggtcactgggtatcctcctctatgacatggtgtgtggggacattcccttcgagagg
gaccaggagattctggaggctgagctccacttccctgaccacgtctccccagattgctgt
gccctaattcgccggtgcctggctcccaagccttctgcccggccctcactggaagagatc
ctgctggacccctggatgcagacaccagccgaggatgcacccctcagcacccccaaagga
gaccccacccccttggcctggtccctgctgccctag

DBGET integrated database retrieval system