KEGG   Trichechus manatus latirostris (Florida manatee): 101345867
Entry
101345867         CDS       T05135                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101345867
   04115 p53 signaling pathway
    101345867
   04218 Cellular senescence
    101345867
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101345867
   05206 MicroRNAs in cancer
    101345867
   05203 Viral carcinogenesis
    101345867
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101345867
   05225 Hepatocellular carcinoma
    101345867
   05214 Glioma
    101345867
   05220 Chronic myeloid leukemia
    101345867
   05218 Melanoma
    101345867
   05219 Bladder cancer
    101345867
   05223 Non-small cell lung cancer
    101345867
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101345867
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101345867
   05163 Human cytomegalovirus infection
    101345867
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101345867
   01522 Endocrine resistance
    101345867
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2
Other DBs
NCBI-GeneID: 101345867
NCBI-ProteinID: XP_004373618
UniProt: A0A2Y9DFB1
LinkDB
Position
Unknown
AA seq 152 aa
MEPTADSLATAAVRGRAQEVRELLQAGAQPNAPNRYGRRPIQVMMMGSTPVAELLLLHGA
EPNCADPVTLTRPVHDAAREGFLDTLMVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAR
YLRAAAGETEGRGHAHADAAEGAAAGRRQPQL
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagcccaccgccgactcgctggccacggccgctgtccgaggccgggcccaggaggtg
cgggagctgctccaggcgggggcgcagcctaacgcgccgaaccgctacgggcgccgcccg
atccaggtcatgatgatgggcagcacccctgtggccgagctgctgctgctccatggcgcc
gagcccaactgcgccgaccccgtcaccctcacccgaccggtgcacgacgccgcgcgggaa
ggcttcctggacacgctgatggtcctgcatcgcgccggggcacggctggacgtgcgcgac
gcttggggtcgcctgcccgtggacctggctgaggagcggggtcaccgcgatgtcgcccgg
tacctgcgtgcggccgcgggggagactgaaggccgcggccatgcccatgcagatgccgca
gagggtgcagcagccggtcgcagacagccccaactgtaa

DBGET integrated database retrieval system