KEGG   Trichechus manatus latirostris (Florida manatee): 101346088
Entry
101346088         CDS       T05135                                 

Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04066  HIF-1 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04640  Hematopoietic cell lineage
tmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101346088
   04066 HIF-1 signaling pathway
    101346088
   04151 PI3K-Akt signaling pathway
    101346088
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101346088
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101346088
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101346088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tmu04052]
    101346088
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  CSF and other factors
   101346088
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101346088
NCBI-ProteinID: XP_004386793
UniProt: A0A2Y9E4B9
LinkDB
Position
Unknown
AA seq 192 aa
MGVRECPALLLLLSLLLLPLGLPVLGSPSRLICDSRVLERYILEAKEAENVTVGCAEDCS
LSENITVPDTKVNFYAWNRMEVGQQAMEVWQGLALLSEAILRGQALLVNSSQPSETLRLH
VDKAVSGLRSLTSLLRVLGAQKEAVSVPDAASAAPLQTFSVDTLCKLFQIYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgtcctgccttgctgcttctgctgtctttgctgctgcttcctctg
ggcctcccagtcctgggctccccctcgcgcctcatctgtgacagccgagtcctggagcgg
tacatccttgaggccaaggaggctgagaatgtcacggtgggctgtgctgaagactgcagc
ttgagtgagaatatcaccgtcccagacaccaaggttaatttctatgcctggaataggatg
gaggtcggccagcaggccatggaagtctggcagggcctggccctgctctcagaagccatc
cttaggggccaagccctgttggtcaactcttcccagccctcggagaccctgcggctccat
gtggacaaagccgtcagcggtctgcgcagcctcacctccctgcttcgggtgctgggagcc
cagaaggaagccgtctccgttccagatgcagcctctgctgctccactccaaacattctct
gtggatactttgtgcaaacttttccaaatctactccaatttcctccggggaaagctgaag
ctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system