KEGG   Trichechus manatus latirostris (Florida manatee): 101346172
Entry
101346172         CDS       T05135                                 

Definition
(RefSeq) period circadian protein homolog 2
  KO
K02633  period circadian protein 2
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04710  Circadian rhythm
tmu04713  Circadian entrainment
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    101346172
   04713 Circadian entrainment
    101346172
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101346172
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101346172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101346172
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101346172
SSDB
Motif
Pfam: Period_C PAS_3 PAS PAS_11
Other DBs
NCBI-GeneID: 101346172
NCBI-ProteinID: XP_023596618
UniProt: A0A2Y9RY51
LinkDB
Position
Unknown
AA seq 1295 aa
MNGYAGFPPSPSDPSRGVLEPKPGRAPLLEDVEMSSSCSRNESSENRSTGQAGDCDDSRG
PGMLGRPAALQGPNGFNLIMATSEHNPSTSGCSEQSGKADMHRELRKTLKELKVHLPADK
KAKGRANTLATLKYALRSVKQVKANEEYYQLLMSGDSHPCSLNVPSYTVGEIESKASEHI
VKNADMFAVAVSLVTGKILYISSQAASVFHCKRDAFTDTKFVEFLAPHDVSMFHSSTTPY
KLPSWGTCSGADSFTRECMEGKSFFCRVRRAFNGGPADPTVPVDPKGACSLLSTACCRGG
CQRTSPFHVKAGLGLPCALWLGRDLAPQCQPVGSVVEVVVGQRSRHPCTCPVPASSPDAH
SAPRIPPEKRIFTTTHTPNCLFQDVDERVVPLLGYLPQDLVESPMLLQLHPSDRPLMLAI
HRKILQSGGQPFDYSPIRFRTRNGEYITLDTSWSSFVNPWSRKISFIIGRHRVRVGPLNE
DVFATQSGVEEKTSHPGIQELTEQICQLLLQPVPYSGSSGYDSLGSNGSHEHLMSQTSSS
DSNGHEDTHQRKPGICKNGNRAKTKSHYSHELTEQKKKPITELQSHPPILMKAAPATDRD
GAGAGVPRATFPEELVCRAQPACSYQQVSCLDSVIRYLESCSEATTLKRKCEFPASAPAL
NASDKRKATGASQVHTALLKPAEEKSHSDVTTHLTSLTLPGKAESVVSLTSQCSYSSTIV
HVGDKKLQPELEMIEDATSGAESLDGPAGPVLSCSLGPEKEPFKKLGLTKEVLAAHTQKE
EQSFLHKLKEMRKLSTFSSCCPHYLQERPRGQSSQLTAPGLRNASGMHSSWKKPGKNRKL
KSKRAKLRDSSGSTASGQPATTRAPLAGLNATAWSPSNTSQSSCPAVPFPAPGPAYSLPV
FPTAPHTGFAVPVGAQPDFSVQPPPFTAPLGPVMAFMLPSYPFPAVTPSLPQAFFPGQTN
FPGHPEMIPISEPVFPGRSPFPTQPCACPPSQHGQLASRAATPATPSSTTGPVGRASPPI
FQSRSSSPLQLNLLQLEEAPEGSAAAAGTVGTTAAGLDAKPATSQDHPLKARPTLHEPSE
AQHSDALSTSSDLLDLLLNEDLCSATGSALSGSGASATSDSLGSRSLGCTVSRSGTGSSD
TSHSSKYFGSIDSSENNPKVETSTHVGESEHLIRHVLQDPIWVLMADSDNSIMMTYQTPA
RDLAEVLKEDREKLRLLQKLQPQFTEAQKQELREVHPWVQTGGLPAAMDVRECVYCGNKG
KGNFPAPHEEDIPALGLSKATDAKEENGPPTESGK
NT seq 3888 nt   +upstreamnt  +downstreamnt
atgaatggctatgccggatttcctcccagccccagtgacccctccaggggcgtgctagaa
cccaagcccggccgagccccgctcctggaagacgtggagatgagcagcagctgcagcaga
aatgaatccagtgagaaccgctccacagggcaggctggcgactgtgacgacagcagggga
ccggggatgctgggccggccggccgccctgcagggcccaaatggcttcaacctgatcatg
gccacgtccgaacacaacccgtccacaagtggctgcagtgagcagtctggcaaagcagac
atgcacagagagctgagaaagaccctgaaggagctgaaggtccacctccctgccgacaag
aaggccaaagggcgggccaacacgctggccaccctgaagtacgccctgcggagcgtgaag
caggtgaaagctaacgaagagtattaccagctgctaatgtccggtgacagccacccctgc
agtctgaacgtgccgtcctacacggtcggggagattgagagcaaggcctctgagcacatc
gtgaagaacgcggatatgtttgcggtggccgtgtccttggtgacggggaaaattctgtac
atctccagccaagctgcatccgtctttcactgcaagagagatgccttcaccgataccaag
ttcgtggagttcctggcgccccacgacgtcagcatgttccacagctccactaccccgtac
aagctgccgtcttggggcacctgcagcggggcagattctttcactcgagaatgcatggag
gggaagtctttcttttgtcgtgtcagacgagcttttaatggcggacctgcggacccaacg
gtgcccgtggaccccaaaggtgcatgcagcctgctgtccactgcatgctgtaggggaggg
tgccagagaacctcgcccttccacgtgaaggcgggtttggggctgccctgcgccctgtgg
cttggccgggacctggccccacagtgccagcctgtgggctctgtggtggaggtggtggtc
ggtcagaggtcacgccatccctgtacctgcccggtacctgccagcagtccagatgcccac
agtgcccctagaattcctcctgagaagagaattttcacaaccacgcatacaccaaattgc
ttgttccaggacgtggatgaaagggtggtccccctcctgggctacctgcctcaagacctg
gtggagagcccgatgctgctgcagctgcacccaagcgacagacccctgatgctggccatc
cacaggaagatcctgcagtctggcgggcagcctttcgactattcgcccatccgcttccgc
acccggaatggcgagtacatcacgctggacaccagctggtccagcttcgtcaacccctgg
agcaggaagatctccttcatcatcgggaggcacagagtcagggtgggccccttgaatgaa
gacgtgtttgcgacccagtcaggtgtggaggagaagacctcgcaccctggcattcaggag
ctcaccgagcagatctgccagctgctgctgcagcccgtgccctacagtggctctagcggc
tatgacagcctgggcagcaacgggtcccacgagcacctcatgagccagacatcctccagt
gacagcaacggccacgaggacacccaccagaggaaacccggcatttgtaaaaatggtaac
agggccaaaaccaaaagtcattattctcatgaactcacagaacaaaagaaaaaacctatt
acagagctgcagagtcatccccctatcctgatgaaggcggccccagccacagacagggat
ggcgcgggggctggcgtccccagggccaccttccccgaggagctggtgtgcagggcccag
ccggcctgctcctaccagcaggttagctgcctcgacagcgtcatcaggtacctggaaagc
tgcagcgaggccaccacgttgaagaggaagtgcgagttcccggccagcgccccggccctg
aacgccagtgacaagcgcaaggcgacgggagcctcgcaggtgcacacagccctgctgaag
cctgccgaggagaagagccactcagacgtcaccacacacctgacctcattgacactgcct
ggcaaagcggagagcgtggtgtccctcaccagccagtgcagctacagcagcaccatcgtc
cacgtcggagacaagaagctgcagcctgagctagaaatgatcgaagatgccacaagcggg
gccgagtccctggacggcccagccggccccgtgctgagctgcagcctgggccctgagaag
gagcccttcaagaagctgggcctcaccaaggaggtgctggcggcgcacacgcagaaggag
gagcagagcttcctgcacaagttgaaggagatgcggaaactcagcacattcagctcatgc
tgtcctcactacttacaggaaaggcccagggggcagtcaagccagctaactgctcctgga
ctaagaaatgcttctgggatgcattcatcatggaaaaaacccgggaagaacaggaagctc
aagtccaagcgggccaagctccgtgactcgtccgggagcacggcatcaggacagccggcc
acaacccgcgccccgctcgcgggcctcaatgccacggcctggtcgccgtccaacacatcc
cagtccagctgcccggctgtgcccttccccgcccccgggccagcctactccctgcccgtg
ttccccacagccccccacactggcttcgcggtgcccgtgggcgcccagcccgacttctcg
gtccagcccccgccgttcacagcccccctgggtccagtcatggcattcatgctgcccagc
tacccctttcctgccgtgaccccgagcctaccccaggccttcttccctggccagactaac
tttccgggccaccccgagatgatacccatctcagagcctgtgttccccggtcggagcccg
ttccccacacagccgtgcgcctgtcccccgtcacagcacgggcagctggcatcacgtgca
gccaccccggccaccccctcgtcaaccaccgggcccgtgggccgggcctccccgcccata
ttccagtcccgcagcagctcgcccctgcagctcaacctgctgcagctggaggaggccccc
gagggcagcgctgcggctgcagggaccgtggggaccacggctgcagggctggacgccaag
ccagccacgtcccaggaccacccgctgaaggcacggcccacgctccatgaaccctcggag
gcccagcacagcgatgccctctccacatccagcgacctgcttgacctcctgctgaacgag
gacctctgctcggccacgggctcggccctgtcggggagtggggcctctgccacctcagat
tcgctgggctccaggtcgctggggtgcaccgtgtccagaagtgggacaggcagcagtgac
accagtcacagcagcaaatacttcggaagcatcgactcctcagagaataatcccaaagtg
gaaacaagcacgcacgtgggcgagagtgagcacctcatcaggcacgtcctccaggacccc
atctgggtgttgatggccgactcggacaacagcatcatgatgacgtatcagacgcctgcc
cgagatcttgctgaggtcctcaaggaggacagagagaagctgagacttctgcagaagctc
cagccccagttcacagaagcccagaagcaggaacttcgtgaagtccacccctgggtgcag
accggtggcctgcctgcggccatggacgtgcgggaatgtgtttactgtggaaacaagggc
aaaggcaactttcctgcaccgcacgaggaagatattcctgctctgggactcagcaaagcc
acagacgccaaagaagaaaatggaccccccactgagtcaggaaaatga

DBGET integrated database retrieval system