KEGG   Trichechus manatus latirostris (Florida manatee): 101346679
Entry
101346679         CDS       T05135                                 

Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04110  Cell cycle
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101346679
   04218 Cellular senescence
    101346679
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101346679
   05206 MicroRNAs in cancer
    101346679
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101346679
   05225 Hepatocellular carcinoma
    101346679
   05226 Gastric cancer
    101346679
   05214 Glioma
    101346679
   05220 Chronic myeloid leukemia
    101346679
   05218 Melanoma
    101346679
   05219 Bladder cancer
    101346679
   05215 Prostate cancer
    101346679
   05224 Breast cancer
    101346679
   05222 Small cell lung cancer
    101346679
   05223 Non-small cell lung cancer
    101346679
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101346679
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101346679
   05161 Hepatitis B
    101346679
   05160 Hepatitis C
    101346679
   05163 Human cytomegalovirus infection
    101346679
   05167 Kaposi sarcoma-associated herpesvirus infection
    101346679
   05169 Epstein-Barr virus infection
    101346679
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101346679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101346679
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101346679
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101346679
NCBI-ProteinID: XP_004384053
UniProt: A0A2Y9E0Q6
LinkDB
Position
Unknown
AA seq 459 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAATASMDKRGLLASTGFPAAAAAAPGAYIQILT
TNTSTTSCSLQSGGGAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGS
GGGPPAKRRLELGDSGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLL
TKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSL
SEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRK
ISGLKDQTVIVVKAPPETRLEVPDPLESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQ
DHNGNISKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNLL
PPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggcggggag
ggggcggctgtcgtcgccgccgctgctacagcctccatggacaaaaggggactgctagcc
agcacgggcttccccgccgccgctgccgccgccccgggcgcatacatccagatcctcact
acgaacacttccaccacctcctgttccctccaaagcggcggcggtgccgccggccccctc
ctccccagtgcccccggcgcggagcagaccgccggcagcctcctctacaccacgccgcac
ggaccctccagcagagccgggctgctgcagcagccaccagcgctgggacgcggcggcagc
ggcggcggccctccggcaaagcgaaggctggagctaggagacagcggtcatcagtacctc
tcagatggtttaaaaacccccaagggcaaaggaagagctgcgcttcgaagtccagatagt
ccaaaaactccaaaatctccctcagaaaaaacacggtatgatacgtcacttggtctgctc
accaagaagttcattcagctactgagccagtcacctgatggggtcttggatttgaacaag
gcagcagaggtgcttaaagtgcaaaagagaaggatttatgacatcaccaatgtcctggaa
ggcatccacctcattaagaagaaatctaaaaacaacgttcagtggatgggctgcagtctg
tctgaggatgggggcatgctggcccagtgccaaggcctgtcaaaggaagtaaccgagctc
agtcaggaagagaagaaactagatgaactgatccaaagctgtacactggacctcaaactg
ttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcgaaaa
attagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaagactt
gaagtgcctgacccactagagagcctacaaattcatttggcaagtacccaaggacccatt
gaggtttacttatgtccagaagagactgaaacacacagcccaatgaaaacaaacaaccaa
gatcacaatgggaatatctctaaacccacttccaaagacttggcttcaaccaactcagga
catagcgattgctccatttctatggcaaacctttctcctttggcctctcccgccaatctt
ttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaacttactg
ccccccctgctccaagaagactatctactaagccttggggaggaagaaggcatcagtgat
ctctttgatgcttatgatttggaaaagctcccattggtggaagactttatgtgtagttga

KEGG   Trichechus manatus latirostris (Florida manatee): 101357348
Entry
101357348         CDS       T05135                                 

Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04110  Cell cycle
tmu04137  Mitophagy - animal
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101357348
  09143 Cell growth and death
   04110 Cell cycle
    101357348
   04218 Cellular senescence
    101357348
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101357348
   05206 MicroRNAs in cancer
    101357348
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101357348
   05225 Hepatocellular carcinoma
    101357348
   05226 Gastric cancer
    101357348
   05214 Glioma
    101357348
   05220 Chronic myeloid leukemia
    101357348
   05218 Melanoma
    101357348
   05219 Bladder cancer
    101357348
   05215 Prostate cancer
    101357348
   05224 Breast cancer
    101357348
   05222 Small cell lung cancer
    101357348
   05223 Non-small cell lung cancer
    101357348
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101357348
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101357348
   05161 Hepatitis B
    101357348
   05160 Hepatitis C
    101357348
   05163 Human cytomegalovirus infection
    101357348
   05167 Kaposi sarcoma-associated herpesvirus infection
    101357348
   05169 Epstein-Barr virus infection
    101357348
   05165 Human papillomavirus infection
    101357348
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101357348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101357348
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101357348
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 101357348
NCBI-ProteinID: XP_004370641
UniProt: A0A2Y9D9V8
LinkDB
Position
Unknown
AA seq 461 aa
MCRGWGGATTPRAGSVWSGGGECEQVWHRPDKACARPVLRLAVPHRTASSSRPPSPVRRS
AANGCDRRRLRHSQAPAAPAAGPRDADLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLE
TDHQYLAESSGPGRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLDLLSRSSDGVVDLNW
AAEELKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTAVGIGGRLEGLTQDLRHLQE
SERQLDHLIHVCTTQLQLLSEDADSQRLAYVTCQDLRSIADPAEQMVVVIKAPPETQLQA
VDSSETFQIYLKSKQGPIDVFLCPEESSGGISPGKTPSQAAASPGEEDKVAVPVTTVPPP
PSPPSSPATDPGQSLLSLEQEPLLSRMGGLRAPVDEDRLSPLVAADSLLEHVREDFSGLL
PEEFISLSPPHEALDYHFGLEGEGIRDLFDCDFGDLTPLDF
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtgccggggctggggcggggctacaacgcctcgggctgggagtgtctggtctgggggc
ggggaatgtgaacaagtctggcaccgccccgacaaagcctgcgcgcgccccgtcctgcga
ctggctgtgccgcaccgcaccgcctcctcgtcccgccccccgtcgccggtccggcgctct
gcagccaatggatgcgaccgtcgccgcctccgtcacagccaagctcccgccgcgcccgcc
gctggcccccgtgatgccgacctactgctcttcgccacgccacaggcgccccggcccaca
cccagcgctccgcgccctgcgctcggccgcccaccggtgaagcggaggctggacctggaa
actgaccatcagtacctggctgagagcagtgggccaggccggggcaggggccgccaccca
gggaaaggtgtgaaatctccgggggagaagtcacgctatgagacatcactgaatctgacc
accaaacgcttcctggacctgctgagccgctcatctgatggcgttgttgacctgaactgg
gcagccgaggagctgaaggttcagaaacggcgcatctacgatatcaccaatgtccttgag
ggcatccagctcatcgccaagaagtccaagaaccacatccagtggctgggcagccacaca
gcggtgggaatcggtgggcgacttgaaggactgacccaggacctccggcacctacaagag
agcgagcggcagctggaccacctgatccacgtttgtaccacacagctgcagctgctctct
gaggatgctgacagccagcgcctggcctacgtgacctgccaggacctacgcagcattgca
gaccctgcagagcagatggttgtggtgatcaaggcccctcccgagacccaacttcaagct
gtggactcctcggagacctttcagatctaccttaagagcaaacaaggccccattgatgtt
ttcctgtgtcctgaggaaagctcgggtgggatcagccctggaaagaccccaagccaggca
gcggcttctcctggggaggaggacaaggtggcagtccctgtcaccacagtaccaccacca
ccatcacctccatcatctcctgccacagatcccggccagtccctgctcagcctggagcaa
gaaccgctgctgtcccggatgggcggcctgcgggcccctgtggatgaggaccgcctgtcc
ccgctggtggcggccgactcactcctggagcatgtgcgggaggacttctctggcctcctc
cctgaggagttcatcagcctgtcccctccccatgaggccctcgactaccactttggcctt
gagggcgagggcatcagagacctgttcgactgtgactttggggacctcacccccttggat
ttctga

KEGG   Trichechus manatus latirostris (Florida manatee): 101357556
Entry
101357556         CDS       T05135                                 

Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04110  Cell cycle
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101357556
   04218 Cellular senescence
    101357556
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101357556
   05206 MicroRNAs in cancer
    101357556
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101357556
   05225 Hepatocellular carcinoma
    101357556
   05226 Gastric cancer
    101357556
   05214 Glioma
    101357556
   05220 Chronic myeloid leukemia
    101357556
   05218 Melanoma
    101357556
   05219 Bladder cancer
    101357556
   05215 Prostate cancer
    101357556
   05224 Breast cancer
    101357556
   05222 Small cell lung cancer
    101357556
   05223 Non-small cell lung cancer
    101357556
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101357556
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101357556
   05161 Hepatitis B
    101357556
   05160 Hepatitis C
    101357556
   05163 Human cytomegalovirus infection
    101357556
   05167 Kaposi sarcoma-associated herpesvirus infection
    101357556
   05169 Epstein-Barr virus infection
    101357556
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101357556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101357556
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101357556
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA
Other DBs
NCBI-GeneID: 101357556
NCBI-ProteinID: XP_023587880
UniProt: A0A2Y9QWZ1
LinkDB
Position
Unknown
AA seq 434 aa
MLRGARALAPAAGLPPKGLPAMSPTELWPPGLGSPQLCPATTTYYTSLYPQTVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVPEFRTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGVLEDPSRPGKQQQLGQELKELMSMEQALDQLIQSCSVNFKHLTE
DKTNKRLAYVTYQDLRAVGSFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEVQEPDSPAKEPLPSTSTLDPSPDSAQPSNGTSPEIVEPEASSVPAMTPQQVPQP
PLVPLEATDSMLELPHPLLQQTEDQFLSPTLECSSPLISFSPPLDQDDYLWGLDGGEGIS
DLFDSYDLGDLLIN
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgctgcgaggggcccgggccctggctccggccgctggactacccccaaagggactgccc
gcgatgagccccaccgagctgtggccgcccggactcggcagcccacagctctgtccggcc
accaccacctactacacctcgctgtacccgcagacggtgcctcccgccgcggcgccgggc
acctgcctcgacgccacccctcacggaccagagggccaagctgtgcgatgcgtgcccgca
ggccggctgccggccaagaggaagctggacctagaggggatcgggcggcctgcagttcct
gaattccggactcccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaagtcccctggagagaagacacggtatgacacgtcactggggctgctcaccaagaag
ttcatttacctcctgagcgagtccgaggatggggtcctggacctgaactgggccgcggag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggagtgcttgaagat
ccctcccggcctgggaagcagcagcagctaggacaggagctgaaggagctgatgagcatg
gagcaggccttggaccagctcatccagagctgctctgtgaactttaagcacctgactgag
gacaagaccaacaagagactggcctatgtgacttaccaggacctccgggctgttggcagc
tttaaggaacagacggtaattgccgtcaaagcccctccgcagacgagactggaagtgcct
gataggagcgaggagaatctacagatatatctaaagagtacccaaggacccatcgaagtc
tacttgtgtccggaggaagtgcaagagccagacagccctgccaaggagccactgccttcc
acctccacccttgaccccagccctgactctgcccagccaagcaacggtaccagccctgag
atcgtggaacctgaagcatcctcagtgccagcgatgactccccagcaggtcccgcagcca
ccccttgtccccctggaggccactgacagcatgttggagctgccacatccacttctgcag
cagactgaggaccagttcctgtccccaacgctggaatgcagctccccactcatcagcttc
tccccacccttggatcaggacgactacctgtggggcctggatgggggcgagggcatcagt
gacctcttcgactcctatgaccttggggacctgttgattaattga

DBGET integrated database retrieval system