KEGG   Trichechus manatus latirostris (Florida manatee): 101347392
Entry
101347392         CDS       T05135                                 

Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04062  Chemokine signaling pathway
tmu04068  FoxO signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04510  Focal adhesion
tmu04540  Gap junction
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04714  Thermogenesis
tmu04722  Neurotrophin signaling pathway
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04935  Growth hormone synthesis, secretion and action
tmu05034  Alcoholism
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101347392
   04012 ErbB signaling pathway
    101347392
   04014 Ras signaling pathway
    101347392
   04630 JAK-STAT signaling pathway
    101347392
   04068 FoxO signaling pathway
    101347392
   04072 Phospholipase D signaling pathway
    101347392
   04151 PI3K-Akt signaling pathway
    101347392
   04150 mTOR signaling pathway
    101347392
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101347392
   04540 Gap junction
    101347392
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101347392
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101347392
   04660 T cell receptor signaling pathway
    101347392
   04662 B cell receptor signaling pathway
    101347392
   04664 Fc epsilon RI signaling pathway
    101347392
   04062 Chemokine signaling pathway
    101347392
  09152 Endocrine system
   04910 Insulin signaling pathway
    101347392
   04912 GnRH signaling pathway
    101347392
   04915 Estrogen signaling pathway
    101347392
   04917 Prolactin signaling pathway
    101347392
   04926 Relaxin signaling pathway
    101347392
   04935 Growth hormone synthesis, secretion and action
    101347392
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101347392
  09159 Environmental adaptation
   04714 Thermogenesis
    101347392
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101347392
   05206 MicroRNAs in cancer
    101347392
   05205 Proteoglycans in cancer
    101347392
   05231 Choline metabolism in cancer
    101347392
  09162 Cancer: specific types
   05210 Colorectal cancer
    101347392
   05225 Hepatocellular carcinoma
    101347392
   05226 Gastric cancer
    101347392
   05214 Glioma
    101347392
   05221 Acute myeloid leukemia
    101347392
   05220 Chronic myeloid leukemia
    101347392
   05211 Renal cell carcinoma
    101347392
   05215 Prostate cancer
    101347392
   05213 Endometrial cancer
    101347392
   05224 Breast cancer
    101347392
   05223 Non-small cell lung cancer
    101347392
  09165 Substance dependence
   05034 Alcoholism
    101347392
  09172 Infectious disease: viral
   05161 Hepatitis B
    101347392
   05160 Hepatitis C
    101347392
   05163 Human cytomegalovirus infection
    101347392
   05165 Human papillomavirus infection
    101347392
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101347392
   01522 Endocrine resistance
    101347392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tmu04990]
    101347392
Domain-containing proteins not elsewhere classified [BR:tmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101347392
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 101347392
NCBI-ProteinID: XP_004370899
UniProt: A0A2Y9DBC1
LinkDB
Position
Unknown
AA seq 1328 aa
MQQAQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEDLIFQLLNKLCM
AQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDDI
GLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDIE
KIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDIL
SPKFNEHFSKLMARPAVALHFQSISDGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKAC
SEEQEDEECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVSPFYNRQLRSKHLAIKKMN
EIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQSRLPGY
NNAEYRLKEKFVMRKTQVCDKEDTCECKHAFELISKDENSIVFAAKSAEEKNNWMAALIS
LQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKG
GTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLAI
EKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVRG
KAMKKWVESIAKIMKRKKQAQANGISHNITFESPPPPIEWHISRSGQSETFDLMTLHPIE
IARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAE
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRK
VAEITGEIQQYQNQPYCLRIEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCKQ
PPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTMS
APTSPNTPCTPPVSASSELSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLSE
EPLVPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPVPIGAFDGPLH
SPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPMGHLHRDVRDASTCPNSPNTPPS
TPSPRVPRRCYVLSSSQNNLPHPPAPPVPPRQNSSPHLPKLPPKTYKRELLHPSLYRLPL
LENAETPQ
NT seq 3987 nt   +upstreamnt  +downstreamnt
atgcagcaggcgcagccgtacgagttcttcagtgaggagaatagtccgaaatggcgggga
ctgctggtctcggccctgcgaaaggttcaggagcaagtacaccccaacctctcagctaat
gaagagtctctctattatattgaagacctgatttttcaactacttaataaattatgcatg
gcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttccccatcca
attgataaatgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaagaaat
cctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttaggatacaaa
gtagactaccatgtctccttatatattgtggctgtactagagtatatatcagctgatatt
ttgaaactggctggtaattatgtttttaatatccggcattatgaaatatctcagcaggac
attaaagtgtcaatgtgcgcagacaaggttttgatggacatgttcgatcaggatgacata
ggtttggtttctctctgtgaagatgaacctagttcttcaggtgaattaaactactatgac
cttgtcagaactgaaattgcagaagaaagacagtatttacgggaactaaatatgatcata
aaagtatttcgagaagccttcctttctgacagaaagctgtttaaaccttctgatattgaa
aagattttcagcaacatttcagatatccatgaattgaccgtgaaacttttaggcttgatt
gaagacacagttgaaatgactgatgaaagcagtccacatcccttagctggcagctgtttt
gaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatcctt
tcacccaagtttaatgaacatttcagtaagttgatggcgagacccgcagttgctctacac
tttcagtctatttctgatgggtttaaagaggcagttcgttatgtccttccacgccttatg
ctggtgccagtgtaccattgttggcactattttgaattattaaagcaattgaaagcatgt
agtgaagagcaagaagacgaagaatgtttgaaccaagctattactgctctcatgaatctc
caaggtagtatggaccgaatttacaagcagtattcgcctagacgccgacctggggatcct
gtttccccattttataatcgtcaattaagaagcaagcacctggctatcaaaaaaatgaat
gaaatacagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaatgaa
ttcataatggaaggtccattgacaagaattggtgctaaacatgaacgccatatttttctc
tttgatggcttaatgattagctgtaaacctaatcatggccagtccaggcttccaggttac
aataacgcagaatacagattaaaagaaaaatttgtcatgaggaaaacacaagtttgtgat
aaagaagatacttgtgagtgcaaacatgcttttgaattgatatccaaagatgaaaacagc
atagtatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatttct
cttcaatatcgtagtactctagatcgaatgctagattcagttttattgaaagaagaaaat
gagcaaccactgagattaccaagtccagaagtatatcgttttgtggtaaaagactctgag
gaaaatattgtttttgaagacaacttgcagagtcgaagtggaatccccattattaaaggt
ggaactgtggtgaaattaattgaaaggttaacataccatatgtatgcagatccaaatttt
gttcgtacttttcttactacataccgttcgttttgtaaaccacaggaattgctaagctta
ctgattgaacggtttgaaattccggagccagaacctactgaagcggataaattagcaata
gaaaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgcaaggaatacgtccag
ccagtacaacttaggatcttaaatgtgtttcggcattgggtagaacatcatttttatgac
tttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgtaagaggg
aaagctatgaagaaatgggtagaatcaattgctaagatcatgaagaggaagaaacaagct
caggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaatgg
catatcagcagatcaggacagtctgaaacgtttgatcttatgacacttcatccaatagaa
attgcacgtcaactaacacttttggaatctgatctttacaggaaagtccaaccttctgaa
cttgtgggaagcgtatggaccaaagaagataaagaaataaattctccaaatttgttaaaa
atgattcgccataccacaaatctcactctctggtttgaaaagtgcattgtggaagcagaa
aattttgaagaacgggtggcagtactaagtagaattatagaaattctgcaagtttttcaa
gatttgaataatttcaatggcgtattggagatagtcagtgcagtaaattcagtgtcagta
tacagactagaccatacctttgaggcattgcaggaaagaaaacggagaattttggatgaa
gctgtggaattaagtcaagatcactttaaaaaatacttagcaaaacttaagtcaatcaat
ccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaaggg
aataatgattttttaaaaaagaaaggaaaagatttaatcaatttcagtaagagaaggaaa
gtagctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgaata
gaaccagacatgaggaggttctttgaaaaccttaaccccatgggaagtgcatctgaaaaa
gagtttacagattatttgttcaacaagtcactagaaattgagccccgaaactgcaaacag
ccacctcgatttcctaggaaatcaactttctccttaaaatctcctggaataaggccaaat
gcaggccgacatggctctacctcaggcactttacgaggtcatccaacaccattagaaaga
gaaccatgtaaaataagctttagtcgcattgctgaaaccgagcttgaatcaacaatgtca
gcaccaacctctccaaatacaccatgtactccaccagtatctgcttcttcagaacttagt
gtgtttttagatgtggatctcaacagttcctgtggcagcaatagcatctttgctccagtc
cttttgccacattcaaagtctttcttcagttcgtgcggtagtttacataaactaagtgaa
gagccactggttcctcctcctcttcctcctcgaaaaaagtttgaccacgatgcttcaaat
tccaagggaaatatgaaatctgatgatgacccccctgctattccaccaagacagccgcca
cctccaaaagtaaaacccagagttcctgttcctattggtgcatttgatgggcctctacat
agtccacctccaccgccaccaagagatcctcttcctgatacccctccaccggttcccctt
cggcctccagaacacttcataaactgtccatttaatcttcagccgcctccaatggggcat
cttcacagagatgtcagagatgctagtacgtgtccaaattcgccaaacactcctcctagc
acaccctctccaagggtaccacgtcgatgctatgtgctcagttctagtcaaaataatctt
cctcatcctccagctccccctgttccaccaaggcagaattcaagccctcatctacccaaa
ctgccaccaaagacttacaaacgggagcttttgcacccctcattgtacagactgcctttg
ctagaaaatgcagaaactcctcaatga

KEGG   Trichechus manatus latirostris (Florida manatee): 101359592
Entry
101359592         CDS       T05135                                 

Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04062  Chemokine signaling pathway
tmu04068  FoxO signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04510  Focal adhesion
tmu04540  Gap junction
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04714  Thermogenesis
tmu04722  Neurotrophin signaling pathway
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04935  Growth hormone synthesis, secretion and action
tmu05034  Alcoholism
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101359592
   04012 ErbB signaling pathway
    101359592
   04014 Ras signaling pathway
    101359592
   04630 JAK-STAT signaling pathway
    101359592
   04068 FoxO signaling pathway
    101359592
   04072 Phospholipase D signaling pathway
    101359592
   04151 PI3K-Akt signaling pathway
    101359592
   04150 mTOR signaling pathway
    101359592
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101359592
   04540 Gap junction
    101359592
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101359592
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101359592
   04660 T cell receptor signaling pathway
    101359592
   04662 B cell receptor signaling pathway
    101359592
   04664 Fc epsilon RI signaling pathway
    101359592
   04062 Chemokine signaling pathway
    101359592
  09152 Endocrine system
   04910 Insulin signaling pathway
    101359592
   04912 GnRH signaling pathway
    101359592
   04915 Estrogen signaling pathway
    101359592
   04917 Prolactin signaling pathway
    101359592
   04926 Relaxin signaling pathway
    101359592
   04935 Growth hormone synthesis, secretion and action
    101359592
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101359592
  09159 Environmental adaptation
   04714 Thermogenesis
    101359592
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101359592
   05206 MicroRNAs in cancer
    101359592
   05205 Proteoglycans in cancer
    101359592
   05231 Choline metabolism in cancer
    101359592
  09162 Cancer: specific types
   05210 Colorectal cancer
    101359592
   05225 Hepatocellular carcinoma
    101359592
   05226 Gastric cancer
    101359592
   05214 Glioma
    101359592
   05221 Acute myeloid leukemia
    101359592
   05220 Chronic myeloid leukemia
    101359592
   05211 Renal cell carcinoma
    101359592
   05215 Prostate cancer
    101359592
   05213 Endometrial cancer
    101359592
   05224 Breast cancer
    101359592
   05223 Non-small cell lung cancer
    101359592
  09165 Substance dependence
   05034 Alcoholism
    101359592
  09172 Infectious disease: viral
   05161 Hepatitis B
    101359592
   05160 Hepatitis C
    101359592
   05163 Human cytomegalovirus infection
    101359592
   05165 Human papillomavirus infection
    101359592
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101359592
   01522 Endocrine resistance
    101359592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tmu04990]
    101359592
Domain-containing proteins not elsewhere classified [BR:tmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101359592
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 PH_13 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 101359592
NCBI-ProteinID: XP_004369595
UniProt: A0A2Y9D7U3
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSVLDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSAYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINVLSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSTN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPIYHCLHYFELLKQL
EEKSEDQEDKECVKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPSIEWHISKPGHTETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESGIKKFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPENETESTASAP
NSPRTPLTPPPASGASSATDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTSKVYSPRYSISD
RTSVSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaagagaacgcgcccaagtggcgg
gggctgctggtgccagcgctgaaaaaggtccaagggcaagttcatcctacacttgagtct
aatgatgatgcccttcagtatgttgaagaattaattttgcaattattgaatatgctatgc
caagctcagccccgaagtgttttagatgtggaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaagtttctgcttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtacgaaatatacggcactatgaaattacaaaacaa
gatattaaagtggcaatgtgtgccgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatgtattatctttaactgatgaagagccttccacttcaggagagcaaacc
tattatgatttggtaaaagcatttatggcagaaattcgacaatatataagggagctaaat
ctaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcaaccaat
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttattg
ggccacatagaagacactgtagaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccgtatgaatcctatgctcga
gatattttgcggcctggttttcatgatcgtttccttagtcagttatcaaagcctggagcg
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctatttaccactgtctacattactttgagcttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtgtgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcaacaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatatcgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagctaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaaattttttatgagaaaggtacag
attaatgacaaagatgacaccaatgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtaacaatgctacag
gaagagaaggaggagcagatgaggcttcctagtgctgatgtttatagatttgcagagcct
gactctgaagagaatataatatttgaagaaaacatgcaacccaaggctggaattccaatt
atcaaagcaggaactgttattaaactcatagagaggcttacataccatatgtatgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgcaaacctcaggaacta
ctgagtcttattatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaaccccttagtgcagaattaaaaaggtttagaaaagaa
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtcgagcaccac
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaagaatttattggaaca
gtaagaggtaaagcaatgaagaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctccctct
attgagtggcatataagcaaacctgggcatacagagacttttgacctgctcacattacat
ccaatagaaattgctcgacaactcactttacttgaatcagatctctaccgagctgtacag
ccatcagaattagttggaagtgtatggacaaaagaagacaaagaaattaattctcctaat
cttctaaaaatgatccggcacaccactaacctcactctgtggtttgaaaaatgtatcgtg
gaaactgaaaacttggaagaaagagtagcagtggtgagtcgaataattgagattctacaa
gtctttcaagagctgaataacttcaatggtgttcttgaggttgttagtgctatgaactca
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgcgtgcctttctttggaatttatttaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagaacttataaacttcagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcaggtatcaaaaagttctttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtc
cgtccatcaaacccaagacctggcaccatgcgacatcccacacctctgcagcaggagcca
aggaagattagttatagtcggatccctgaaaacgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttccagtgccacagat
gtttgcagcgtatttgattctgatcattcgagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagggcactgatgaggtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcttcgccatctaagatgatgtctaagcatttggacagtccccca
gcaattcctcctaggcaacccacatctaaagtctattcaccacgatactcaatatcggac
cggacctctgtatcagaccctcctgaaagccctcccttgttaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactgcatctccaacctccccctttgggtaaa
aaaagtgaccacagcaatgcattcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcatggcacgagaaggcatctgccatcaccaccattgacacaa
gaagtggaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagacggaccaccgctgttggagaatgcccattcgtcctga

DBGET integrated database retrieval system