KEGG   Trichechus manatus latirostris (Florida manatee): 101347498Help
Entry
101347498         CDS       T05135                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00250  Alanine, aspartate and glutamate metabolism
tmu00410  beta-Alanine metabolism
tmu00430  Taurine and hypotaurine metabolism
tmu00650  Butanoate metabolism
tmu01100  Metabolic pathways
tmu04727  GABAergic synapse
tmu04940  Type I diabetes mellitus
Module
tmu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    101347498
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101347498
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101347498
   00430 Taurine and hypotaurine metabolism
    101347498
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    101347498
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101347498
Enzymes [BR:tmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101347498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 101347498
NCBI-ProteinID: XP_004375584
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MASSTPSSSAAASNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSVFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
NKDGDGIFSPGGAISNMYSIMAARYRYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYIPLYVNATAGTTVYGAFDPIQDIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILLKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEHQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIQDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcgaccccttcctcgtccgccgccgcctcgaacgcgggagcagaccccaat
actaccaacctgcgccccacaacgtatgacacttggtgcggcgtggcccatggatgcact
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgtgttcaaggagaggcagtcctccaagaacttgctctcctgtgaa
aacagtgaccgcgatgcccgcttccggcgcacggagactgacttctccaacttgtttgct
cgagatttgcttccagctaagaacggggaggagcaaactgtgcagtttctactggaggta
gtggacatactcctcaactatgtccgcaagacattcgaccgctccaccaaggtgctggat
tttcatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctctgac
caccctgaatccctggagcagatcctggttgactgcagagacaccctgaagtatggggtc
cgcacaggtcatcctcgctttttcaaccagctctccactggattggatatcattggctta
gccggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcaccc
gtgtttgtcctcatggagcaaataacgcttaagaagatgagagagatagttggatggtca
aataaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgctacaggtacttcccggaagttaagacaaagggcatggccgctgtgccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaggctggggctgca
cttgggtttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcaaaagggatacattcctctttat
gtcaatgcaactgctggcacaactgtttatggagctttcgatccgatacaggatattgca
gatatatgtgagaaatataacctttggctgcatgtcgatgctgcctggggcggagggctg
cttatgtcccggaagcaccgccataaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgctgcagtgctctgccattctcctcaaggaa
aagggtattctccagggatgcaaccagatgtgtgcaggatatctcttccagccagacaag
cagtatgatgtctcctatgacactggagacaaggcaattcaatgtggccgccacgtggac
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaacatcagatc
aacaaatgcctggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgaacacacaaacgtctgcttctggtatattccacaa
agccttaggggcattcaggatagccctgaacgacgggaaaagctacacagggtggctccg
aaaatcaaagctctaatgatggagtcgggcacaaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctcgaacccagctgctacccagtctgatatc
gacttcctcattgaagagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system