KEGG   Trichechus manatus latirostris (Florida manatee): 101348099
Entry
101348099         CDS       T05135                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101348099
   04064 NF-kappa B signaling pathway
    101348099
   04068 FoxO signaling pathway
    101348099
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101348099
   04210 Apoptosis
    101348099
   04115 p53 signaling pathway
    101348099
   04218 Cellular senescence
    101348099
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101348099
   05202 Transcriptional misregulation in cancer
    101348099
  09162 Cancer: specific types
   05210 Colorectal cancer
    101348099
   05212 Pancreatic cancer
    101348099
   05225 Hepatocellular carcinoma
    101348099
   05226 Gastric cancer
    101348099
   05214 Glioma
    101348099
   05216 Thyroid cancer
    101348099
   05220 Chronic myeloid leukemia
    101348099
   05217 Basal cell carcinoma
    101348099
   05218 Melanoma
    101348099
   05213 Endometrial cancer
    101348099
   05224 Breast cancer
    101348099
   05222 Small cell lung cancer
    101348099
   05223 Non-small cell lung cancer
    101348099
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101348099
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101348099
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101348099
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101348099
NCBI-ProteinID: XP_004378548
UniProt: A0A2Y9DQV6
LinkDB
Position
Unknown
AA seq 160 aa
MTLEEIVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPIETQGTAEPRDLHCL
LVTNPHTDAWKSQGLVEVANYCEESRGNNQWVPYIALQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagatcgtggcgtgcgacaacgcggctcagaagatgcagacggtgagc
gcagcggtggaggagcttctggtggctgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggacccggacagcgtggtcctgtgcctcctagcc
atagacgaggaagaggaggatgacatcgctctgcagatccacttcacgctcatccagtca
ttctgctgtgacaacgacattgatatcgtgcgggtctccggtatgcagcgcttggcacag
ctgctgggtgagccgatcgagacccagggcaccgcggagccccgggacctgcactgcctc
ctggtcacgaatccacacacggacgcctggaagagccagggactggtggaggtagccaat
tactgtgaagaaagccgaggaaacaatcagtgggtcccctacatcgccctgcaggagcgc
tga

KEGG   Trichechus manatus latirostris (Florida manatee): 101353013
Entry
101353013         CDS       T05135                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101353013
   04064 NF-kappa B signaling pathway
    101353013
   04068 FoxO signaling pathway
    101353013
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101353013
   04210 Apoptosis
    101353013
   04115 p53 signaling pathway
    101353013
   04218 Cellular senescence
    101353013
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101353013
   05202 Transcriptional misregulation in cancer
    101353013
  09162 Cancer: specific types
   05210 Colorectal cancer
    101353013
   05212 Pancreatic cancer
    101353013
   05225 Hepatocellular carcinoma
    101353013
   05226 Gastric cancer
    101353013
   05214 Glioma
    101353013
   05216 Thyroid cancer
    101353013
   05220 Chronic myeloid leukemia
    101353013
   05217 Basal cell carcinoma
    101353013
   05218 Melanoma
    101353013
   05213 Endometrial cancer
    101353013
   05224 Breast cancer
    101353013
   05222 Small cell lung cancer
    101353013
   05223 Non-small cell lung cancer
    101353013
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101353013
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101353013
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101353013
SSDB
Motif
Pfam: Ribosomal_L7Ae XPA_C
Other DBs
NCBI-GeneID: 101353013
NCBI-ProteinID: XP_004369191
UniProt: A0A2Y9D7T8
LinkDB
Position
Unknown
AA seq 162 aa
MAAASKILAQIEQPTLTSDAVEVWITILATACCSRRGGDQNRHSQSDPDNVVLCLLAADE
DDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLEPDASRATSEGAEQPPDLH
CVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 489 nt   +upstreamnt  +downstreamnt
atggcggctgcctctaaaatcctggctcagattgagcaacccaccctgacctctgatgct
gtggaggtgtggatcaccatcctggccacagcttgttgcagcaggcgcggaggagaccag
aatcgccacagccaaagcgacccggataacgtggtgctgtgcttgctggcggccgacgag
gacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcgttctgctgc
gagaacgacatcaacatcctgcgcgtcagcaaccctggccggctcgccgagcttctgctg
ctggagccggacgcgagccgggcgacgagtgagggcgccgaacagccccccgacctgcac
tgcgtgctggtgacgaatccacattcatcgcaatggaaggatcctgccttaagtcaactt
atttgtttttgccgggaaagtcgatacatggatcagtgggttccagtgattaatcttccc
gaacggtga

KEGG   Trichechus manatus latirostris (Florida manatee): 101361119
Entry
101361119         CDS       T05135                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101361119
   04064 NF-kappa B signaling pathway
    101361119
   04068 FoxO signaling pathway
    101361119
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101361119
   04210 Apoptosis
    101361119
   04115 p53 signaling pathway
    101361119
   04218 Cellular senescence
    101361119
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101361119
   05202 Transcriptional misregulation in cancer
    101361119
  09162 Cancer: specific types
   05210 Colorectal cancer
    101361119
   05212 Pancreatic cancer
    101361119
   05225 Hepatocellular carcinoma
    101361119
   05226 Gastric cancer
    101361119
   05214 Glioma
    101361119
   05216 Thyroid cancer
    101361119
   05220 Chronic myeloid leukemia
    101361119
   05217 Basal cell carcinoma
    101361119
   05218 Melanoma
    101361119
   05213 Endometrial cancer
    101361119
   05224 Breast cancer
    101361119
   05222 Small cell lung cancer
    101361119
   05223 Non-small cell lung cancer
    101361119
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101361119
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101361119
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101361119
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101361119
NCBI-ProteinID: XP_004384292
UniProt: A0A2Y9E197
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRGQETVPESTARMQSAGKALHDLLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSIPLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaggaagtccgcggccaggagacagtcccagaaagcacggccaggatgcag
agcgctgggaaagcgctgcacgaccttttgctgtccgcacagcgccagggctgcctcacc
gccggcgtgtacgagtccgccaaggtcctgaacgtggaccccgacaacgtaactttctgt
gtgctggccgccgacgaggaggacgagggcgacatcgcgctgcagatccacttcacgctc
atccaggctttctgctgcgagaacgatattgacatcgtgcgggttggcgacgtgcagcgg
ctggcggccatcgtgggcgcgggcgacgaggcgggcgcgccaggcgacctgcactgcatc
ctcatctcgaaccccaatgaggatgcgtggaaagaccccgccttagagaagctcagtctg
ttctgcgaggagagccgcagcgtcaacgactgggtgcccagtatccccctccccgagtga

DBGET integrated database retrieval system