KEGG   Trichechus manatus latirostris (Florida manatee): 101348862Help
Entry
101348862         CDS       T05135                                 

Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tmu01002]
    101348862
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101348862
Peptidases [BR:tmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101348862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101348862
NCBI-ProteinID: XP_004378551
UniProt: A0A2Y9DPJ8
LinkDB All DBs
Position
Unknown
AA seq 1062 aa AA seqDB search
MEPTVDDLQLVPAVTKKPPALDATCCRAAITVVVVTSFSVVSLGVLLAFLSAQGVDVEHT
AQLRGIRYASSLQQENSDYYRMLTPTLETLLHFLLRALRTLSLALEEQLLQQGLRARLGD
HGIPLAAYGTIVSAELTGSQKGPLTERDLKSGHCPGNAFSCGNSQCVSKGNPECDDRVDC
ADGSDEAHCDCGLQPAWRTAGRIVGGVEASPGEFPWQASLRENNEHFCGATIVSARWLVS
AAHCFNDFQDPTEWVAYVGTTYLSGSEASTVRARVSKIIKHPFYNTDTADFDVAVLQLAS
PLPFGRHIQPVCLPAASHIFPAQKKCLISGWGYLKEDFLVKPEVLQKASVELLDQGLCTS
LYGHSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTRLRDWILEVIAMASMPLAPTVAPAPATPSSVWPTSPKSPVVNTPTRPTLTPSTVR
LDSATASKPQECGTRPALEKPIRIVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVEQVRAHLGTASLMGVGGSPVKVGLKRVVLHPLYHAGTLDFDVAVLELAS
PLLFNKYVQPVCLPLAIQKFPVGRKCMISGWGNTREGNVTKPDILQKASVGIIDQKTCSI
LYNFSLTDRMICAGFLEGRVDSCQGDSGGPLACEETPGVFYLAGIVSWGLGCAQVKKPGV
YARITRLKGWILETMSSDPLPTAPPSTARTPTTPIHALRSTAGLTVPGATTSNTTPQPTS
RATSQPASTTVTVTSTTTRRQTPLPNTPEPSTHSQLSDCGLAPAAALTRIVGGSAAGHGE
WPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGADGQLER
VARIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPEPALRPPAGARCVITGWGSV
REGGAMARQLQKAAVRLLNEQTCRRFYPVQISSRMLCAGSPQGGVDSCSGDAGGPLACRE
PSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQNIQD
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacagttgatgaccttcaactcgtgcccgctgtaacaaagaagccccctgcc
ctggacgccacatgctgtcgagctgccatcaccgtggtggtggtgacaagcttcagtgtt
gtctccctgggagtccttctggccttcctttctgcacagggcgtggatgtggagcacacg
gcccagctgcgagggatccgctacgccagcagcttgcagcaggagaactcagactattac
cggatgctgacgcccaccctggagacgctgctgcacttcctgctacgagctctccgcacg
ctgagccttgccttggaggagcaactcctgcagcaggggctgcgggccaggcttggggac
cacggcatccccctggccgcctatggcaccatcgtgtctgccgagctcacaggaagccag
aaggggccacttacagaaagagacttaaaatcaggtcactgtccagggaatgccttttcc
tgtgggaacagccagtgtgtcagcaaggggaacccagagtgtgacgacagagtggactgt
gctgacggctccgatgaggcccactgcgactgcggtttgcaacctgcctggaggacagct
gggaggatcgtgggcggtgtggaagcgtccccaggggagttcccgtggcaagccagcctc
cgtgaaaacaacgagcacttctgtggggccaccatcgtgagcgcgagatggctggtgtct
gctgcccactgtttcaacgacttccaggacccgacagagtgggtggcctacgtgggcacg
acctacctcagtggctcggaggccagtactgtgcgggcccgggtctcaaagatcatcaag
caccccttttacaacaccgacaccgccgacttcgacgtggccgtgctccagctggccagc
ccgctgcccttcggcaggcacatccagcccgtgtgcctcccggctgcctcgcacatcttt
ccagcccagaagaagtgcctcatctccggctggggctacctcaaggaggacttcttggtc
aagccggaggtgctgcagaaagccagcgtggaattgctggaccaaggcctgtgcaccagt
ctctacggccactcgctcacggacaggatgctgtgcgccggctacctggacggcaaagtg
gattcctgccagggcgactcgggggggcccctggtctgcgaagagccttccggaaggttc
ttcctggcgggcatcgtgagctggggaatcggttgtgcggaagcccggcggccgggtgtc
tacgcccgcgtgactaggcttcgtgactggatcctggaggtgatcgccatggccagcatg
cccctggcccccaccgtggcacctgcccctgccacccccagcagtgtttggcccaccagc
cctaagagccccgtggtcaacacccccaccagacccacgctgacccccagcacggtgcgc
ctggactcagccaccgcctccaagccacaagaatgcgggaccaggcccgcgctggagaag
ccgatccggatcgtgggcggattcggagccgcctccggggaggtgccttggcaggtcagc
ctgaaggaaggttcccggcacttctgcggagccaccgtggtgggcgaccgttggctgctg
tccgcggcccactgcttcaaccacacgaaggtggagcaggtgcgggcccacctgggcacg
gcgtccctcatgggcgtgggcgggagcccggtcaaggtgggcctcaagcgggtggtgctg
caccccctgtaccacgccggcaccctggactttgacgtggccgtgctggagctggccagc
cccctcctcttcaacaagtacgtccagcccgtctgcctgcccctggccatccagaagttc
cccgtgggtcgcaagtgcatgatctccggatggggcaacacccgggaaggaaacgtgacc
aagcctgacattctccagaaagcctcggtggggatcatagaccagaagacctgcagcatt
ctctacaacttctccctcaccgaccggatgatctgtgccggctttctggaaggcagagtc
gattcctgccagggcgactccgggggccccctggcctgtgaggagacccccggcgtgttc
tacctggcagggattgtgagctggggacttggctgtgcccaggtcaagaagccgggtgtg
tatgcgcgaatcaccaggctgaagggctggatcctggagaccatgtcctccgaccccctc
cccacagctcccccctcgaccgcaaggacacccaccaccccaatccacgccctgaggtca
actgctggcctcacagtcccgggagccacgaccagcaacaccacgccccagcccaccagc
agggccaccagccagcctgccagcaccaccgtcaccgtcacgagcaccaccaccaggagg
cagacgccacttccaaacaccccagagcccagcacacactcccagctctcagactgtggc
ctggcgcccgcggcggcgctcaccaggatcgtgggcggcagcgcggcgggccacggggag
tggccatggcaggtgagcctgtggctgcggcgccgggagcaccgctgcggcgctgtgctg
gtggccgagaggtggctgctgtcagcggcgcactgcttcgacgtctacggggaccccaag
cagtgggcggctttcctgggcacgccgtttctgagcggcgccgatgggcagctggagcgc
gtggcgcgcatctacaagcaccccttctacaacctctacacgctcgactacgacgtggcg
ctgctggagctcgcggggcccgtgcgccgcagccgcctggtgcgacccatctgcctgccc
gagcccgcactgcggcccccagctggcgcgcgctgcgtcataaccggctggggctcggtg
cgcgagggaggcgctatggcgcggcagctgcagaaggcagccgtgcgactcctgaacgag
cagacgtgccgccgcttctacccggtgcagatcagcagccgcatgctgtgcgccggctcc
ccgcagggcggcgtggacagctgctcgggtgatgctgggggacccctggcttgcagggag
ccctcaggccggtgggtgctaacaggggtcaccagctggggctacggctgcgggcgtccc
cacttccccggtgtctacactcgggtggcagctgtgagaggctggatcggacagaacatc
caggactga

DBGET integrated database retrieval system