KEGG   Trichechus manatus latirostris (Florida manatee): 101348884
Entry
101348884         CDS       T05135                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04020  Calcium signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04144  Endocytosis
tmu04151  PI3K-Akt signaling pathway
tmu04510  Focal adhesion
tmu04540  Gap junction
tmu04630  JAK-STAT signaling pathway
tmu04810  Regulation of actin cytoskeleton
tmu05163  Human cytomegalovirus infection
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101348884
   04014 Ras signaling pathway
    101348884
   04015 Rap1 signaling pathway
    101348884
   04630 JAK-STAT signaling pathway
    101348884
   04020 Calcium signaling pathway
    101348884
   04072 Phospholipase D signaling pathway
    101348884
   04151 PI3K-Akt signaling pathway
    101348884
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101348884
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101348884
   04540 Gap junction
    101348884
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101348884
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101348884
   05206 MicroRNAs in cancer
    101348884
   05230 Central carbon metabolism in cancer
    101348884
   05231 Choline metabolism in cancer
    101348884
  09162 Cancer: specific types
   05214 Glioma
    101348884
   05218 Melanoma
    101348884
   05215 Prostate cancer
    101348884
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101348884
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101348884
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101348884
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tmu04090]
    101348884
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101348884
Protein kinases [BR:tmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101348884
CD molecules [BR:tmu04090]
 Proteins
  101348884
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 101348884
NCBI-ProteinID: XP_004382952
UniProt: A0A2Y9DXC7
LinkDB
Position
Unknown
AA seq 1089 aa
MGNPQRALLFLGCLLTGLGLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVNWQYP
IPVDENPNVEIRNEENNSGLFVTVLEVAGASAAHTGLYTCCYNHTETEDSEVKGRHVYIY
VPDPDVVFVPLGMVDYLVIAEEDDSAIIPCRTTDPETPVTLRNGDEVVHASYDSKQGFNG
TFTVGSYTCEASVRGKTFKTDPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGVTMLEEIKVPTIKLVYTLTIPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKHFVVDIKAYPLPRISWLKDNMTLIENL
TEITTDVERIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAAGTPLPDIDWMICKDIKKCNNETSWTVLANNVSNIITEIYPRG
RSTVEGRVTFTKVEETIAVRCLAKNLLGIENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGITYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEDEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggaatccccaacgagcactcctcttcttaggctgtctcctcacagggctgggcctc
atactctgccagctttcattaccctccatccttcccaatgagaatgaaaaggttgtgcag
ctgaattcgtccttttctctgagatgctttggggagagtgaagtgaactggcagtacccc
atacctgtagacgagaaccccaacgtagagatccgaaatgaggaaaacaacagtggcctt
tttgtgacagtgctggaagtggctggtgcctcggcagcccacactggactgtacacttgc
tgttacaaccacactgagacggaagacagcgaggtcaaaggcaggcacgtgtacatctat
gtgccagacccagatgtagtcttcgtacctctgggaatggtggattatttagtcattgcg
gaggaggatgattctgccatcataccctgccgcacgactgaccctgagaccccggtcacc
ttgcgcaacggtgatgaggtggttcatgcctcctatgacagcaaacagggctttaacgga
actttcaccgtggggtcctacacctgtgaggcttccgtcagagggaagacgttcaagacc
gacccttttaatgtgtatgctttaaaagcaacatcagaacttgacctagaaatggaagct
cttaaaactgtgtataagtcaggagagacgattgtagtcacttgtgcagtctttaacaat
gaagttgttgaccttcagtggacttaccctggagaagtgaagggcaaaggcgtcacaatg
cttgaggaaatcaaagttccaaccatcaagctagtgtacactttgacgatccctgaggct
acagtgaaagacagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatttctgttcatgagaaaggattcattgaaatcaaacccaac
ttcagccagttggaagctgtcaacctgcatgaagttaaacattttgtggtggacataaag
gcctaccctcttcccaggatatcatggctgaaggacaacatgacgctgattgaaaacctg
actgagatcaccactgacgtagaaaggattcaggagataaggtatcgaagtaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactattaactcaagttccctcctccattctggacttg
gttgatgaccaccatggctctacagggggacagactgtgaggtgcacggctgcaggaacc
cctcttcctgacattgattggatgatttgcaaggatattaaaaaatgtaataatgagact
tcatggacggttttggccaacaatgtctcgaacatcatcactgagatctacccccgaggc
aggagcaccgtggagggccgagtgaccttcaccaaagtggaggagaccattgcagttcga
tgcctggctaagaatcttcttgggattgagaaccgggaactgaagctggtggctcccact
ctgcgttctgaactcactgtggcggctgcagtcttggtgctattggtgattgtgatcatc
tcacttattgtcctggtcgtcatttggaaacagaagccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggaccctatgcagctg
ccttatgactccagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggtgcatttgggaaagtggttgaaggaacggcctatggattaagccggtctcagcct
gtgatgaaagtcgcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttaaacattgtaaacttg
ttgggagcctgtacaaaatcaggacctatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagagacagcttcctgagtcaccacccagagaag
ccaaagaaagagttggacatctttggattgaaccccgctgatgaaagcacacggagttat
gttattttatcttttgaaaacaacggcgactacatggacatgaaacaagccgacaccaca
cagtatgtccccatgctagaaaggaaagaagtctctaaatattcggacatccagagatca
ctctacgatcgcccagcctcgtataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttccaaaaattgtgtccaccgggacctggct
gctcgcaatgtcctcctggctcaagggaaaatcgtgaagatctgtgacttcggactggcc
agagatatcatgcatgattctaactacgtgtcaaaaggcagcacctttctccccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccaccctgagcgatgtctggtct
tatggcattctgctttgggagatcttctcccttggtggcacaccctaccctggcatgatg
gtggattcgactttttacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaagtgctggaatagtgagccagagaagaga
ccctccttctaccacctgagtgaaattgtggagaatctgctgcctggacaatataaaaag
agttacgagaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactctgacaatgcgtacattggcatcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggccttgatgagcagagactgagtgcggacagtggctacatcatc
cctctgcccgacatcgaccccgttcctgaggatgaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctacctttatc
aagagagaggatgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtggaggatagcttcctgtaa

DBGET integrated database retrieval system