KEGG   Trichechus manatus latirostris (Florida manatee): 101348932Help
Entry
101348932         CDS       T05135                                 

Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00240  Pyrimidine metabolism
tmu00983  Drug metabolism - other enzymes
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101348932
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101348932
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101348932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-GeneID: 101348932
NCBI-ProteinID: XP_023584937
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQVQVQAPGRGDPRAHVLREKGAAGVQPVEMEFFVPQAVASP
ALCPCSTELMRRVRRFQIAQYKCLVIKYAKDTRYGSGFSTHDRNTMEALPACLLRDVAQE
ALGVAVIGIDEGQFFPDIVEFSETMANAGKTVIVAALDGTFQRKAFGSILNLVPLAESVV
KLTAVCMECFREAAYTKRLGSEKEVEVIGGADKYHSVCRLCYFKKSSSQPPGLDNKENCP
VLGRPGEAVGVRKLFAPQQVLQCNSVH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcatcaacttgcccactgtgctgcccggctcccccagcaagactcgcggccag
gtccaggtgcaggcgccggggcgaggtgatcctcgggcccatgttctcagggaaaagggg
gcggcgggagtccagcccgtggagatggagttcttcgtcccacaggctgtggcctcaccg
gccctttgcccttgtagcacagagctgatgagacgggtccgccgcttccagatcgcacag
tacaagtgcctggtgatcaagtatgccaaggacacccgctacggcagtggcttctccaca
catgacaggaacaccatggaggcattgccagcctgcctgctccgggatgtggcccaggag
gccctgggcgtggcggtcataggcattgacgaaggacagtttttccccgacatcgtggag
ttcagcgagaccatggccaacgctgggaagactgtgatcgtggccgccctggatggaacg
ttccagaggaaggctttcgggagcatcctgaacctggtgccgctggccgagagcgtggtg
aagctgaccgctgtgtgcatggagtgcttccgcgaggctgcctacaccaagaggctgggc
tctgagaaagaggtggaggtgataggcggagcagacaagtaccactcggtgtgccgtctc
tgctacttcaagaagtcctccagccagccgccggggctggacaacaaggagaactgcccg
gtactggggaggccaggggaggcggtgggtgtccggaagctttttgccccccagcaggtc
ctgcagtgcaactcggtccactga

DBGET integrated database retrieval system