KEGG   Trichechus manatus latirostris (Florida manatee): 101349149Help
Entry
101349149         CDS       T05135                                 

Definition
(RefSeq) DNA ligase 3 isoform X2
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03410  Base excision repair
Module
tmu_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101349149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101349149
Enzymes [BR:tmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101349149
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     101349149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 101349149
NCBI-ProteinID: XP_004385477
UniProt: A0A2Y9E316
LinkDB All DBs
Position
Unknown
AA seq 1013 aa AA seqDB search
MTLAFKTLFPQSLRVLSRKELCVFRERHHQPDIRQFSQCSETDLIHGCGLLLRKKPVLSF
QRGSLRPRATCLVFSPGSHVGLCSGSSEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQ
YIADLSSKAASTPKKKAFVQAKLTATGQVTSPAKGASVTNTNRRKFSGFSAKPNNFGEAP
SSPNLKTSLSSSKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQDFLQKGSAGDGFH
GDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLQLSRLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLLNKQEVEKEPGQRRMLSVQASLMTP
VQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPEAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCMYF
NDVSLMDRPLCERRKFLYDNMVEIPNRIMFSEMKQVTKASDLADMINRVMREGLEGLVLK
DVKSPYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSRERADFTV
VTGDEGSSSAGGSNGENGGTLGPAVSRKAPTASSNKPSANAKKAERKLSSPNSKGGDKLT
AKPSPVKVGEKPTLKPCPMKVGEKRKAPDEAPCQAKVLLDIFTGVRLYLPPSTPNFSRLR
RYFVAFDGDLVQEFDMASATHVLGSGDKNPEAQQVSPEWIWACIRKRRLVAPC
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgactttggctttcaagaccctcttcccacaaagcctccgtgtactcagccgaaaagaa
ctgtgcgtattccgagagcgacatcaccaacctgacataagacagttcagccagtgttca
gaaacagatctgattcatgggtgcggcctcctcctgagaaaaaagcctgttctatcattc
cagagaggcagcctaagaccacgtgccacctgccttgttttctctccaggatcgcatgtg
ggactctgcagtggctccagtgagatggccgagcagcggttctgtgtggactatgccaaa
cgtggcactgctggctgcaaaaaatgcaaggaaaagattgtgaagggtgtttgccgaatt
ggcaaagtggtgcccaatcccttttcagagtctgggggtgatatgaaagagtggtaccac
attaaatgcatgtttgagaaactggagcgggcccgggccaccacaaaaaaaatcgaggac
ctcacagagctggaaggctgggaagaactagaagataatgagaaggaacagataacccag
tacattgcagatctgtcttctaaggcagcaagcacaccaaagaagaaagcttttgtccag
gctaagttgacagccaccggccaggtgacgtctccagcaaaaggcgcctctgtaaccaat
actaatcgtcggaaattctctggcttctcagccaagcccaacaactttggggaagccccc
tccagtcctaaccttaagactagcctgtcctcaagcaaatgcgaccctaagcacaaggat
tgtctgctacgggagtttcggaagttgtgcgccatggtggctgaaaatcctagctacaac
acgaagactcagatcatccaggacttcctgcagaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacagtgaagctgctgctgccgggtgtcattaagagtgtttacaac
ctgaatgataagcagattgtgaagctttttagccgcattttcaactgcaatccagatgac
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtctttccccccagctgccaagagcctcctcaccatccaggaggtggatgaattc
ctcctgcagctctctaggctcacgaaggaggatgagcagcagcaggccctgcaggacatc
gcctccaggtgcacagccaatgaccttaagtgcatcatcaggttgatcaaacacgatctg
aagatgaactcaggtgcgaaacacgtgttagatgcccttgaccccaatgcctacgaagcc
ttcaaagcctcacgcaacctgcaggacgtggtggagcgggtccttctcaataagcaggag
gtggagaaggagccaggccagagacgaatgctgagcgtccaggcctcgctgatgacccct
gtgcagcccatgctggccgaggcctgcaagtccatcgagtacgcgatgaagaagtgtccc
aacggcatgttctctgagatcaagtacgatggggagcgagtgcaggtgcataagaacggg
gaccacttcagctacttcagccgtagcctcaagcctgtcctacctcacaaggtggcccac
tttaaggactacatccccgaggctttccctgggggccacagcatgatcttggactctgaa
gtgctcctgatagacaacaagacaggcaaacctctgccctttggaactctgggagtgcac
aagaaagccgccttccaggatgctaatgtgtgcctgtttgtttttgattgtatgtacttc
aatgatgtcagcctgatggacaggcctctgtgtgagcggcggaagttcctttacgacaac
atggttgaaattcccaaccggatcatgttctcagaaatgaagcaagtcacgaaagcttcg
gatttggctgacatgataaaccgggtgatgcgcgaggggttagaggggctggtgctgaag
gacgtcaagagtccatatgagcctgggaagcggcactggctgaaagtgaagaaggactac
ttgaacgagggggccatggctgacacggctgacctggtggtccttggggccttctatggg
caagggagcaaaggtggcatgatgtcgatcttcctcatgggctgctacgaccctggcagc
cagaagtggtgcaccgtcaccaagtgtgcaggcggccacgacgacgcgacgctcgcccgc
ctgcagaaggagctggacatggtaaagatcagcaaggaccccagcaagatacccagctgg
ctgaaaatcaacaagatctattatcctgacttcattgtcccagacccaaagaaagctgcc
gtgtgggagatcacaggggctgagttctccaaatctgaggctcacacagctgatggcatc
tccatccgattccctcgctgcactcgaatccgtgatgataaggactggaaatctgccact
aacctcccccagctcaaggaactgtaccagctttccagggagagggcagacttcactgta
gtgaccggagatgaggggagctccagcgcagggggcagcaatggggagaacgggggcacc
ttggggcctgctgtgtcccgcaaggcccccacagcttcctccaacaaaccctcagccaat
gccaagaaggccgaaaggaagctcagtagccccaacagcaaaggcggcgacaagctgact
gcaaagccttcccctgtgaaagtgggagaaaagccaaccctgaagccttgtcccatgaag
gtgggagaaaagcggaaggctccggacgaggctccgtgccaagcaaaggtgctgctggac
atcttcactggggtgcggctctacctgccgccctccacaccaaacttcagccgtctcaga
cgctactttgtggcattcgacggagacctggtacaggaatttgacatggcctccgccaca
catgtcctgggcagtggggacaagaaccccgaggcccagcaggtctctccagagtggatt
tgggcatgcatccggaaacggagactggtagctccctgttag

DBGET integrated database retrieval system