KEGG   Trichechus manatus latirostris (Florida manatee): 101349186
Entry
101349186         CDS       T05135                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu04012  ErbB signaling pathway
tmu04062  Chemokine signaling pathway
tmu04110  Cell cycle
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04310  Wnt signaling pathway
tmu04340  Hedgehog signaling pathway
tmu04360  Axon guidance
tmu04390  Hippo signaling pathway
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04657  IL-17 signaling pathway
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04728  Dopaminergic synapse
tmu04910  Insulin signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05020  Prion disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05135  Yersinia infection
tmu05160  Hepatitis C
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05213  Endometrial cancer
tmu05215  Prostate cancer
tmu05217  Basal cell carcinoma
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101349186
   04310 Wnt signaling pathway
    101349186
   04340 Hedgehog signaling pathway
    101349186
   04390 Hippo signaling pathway
    101349186
   04151 PI3K-Akt signaling pathway
    101349186
   04150 mTOR signaling pathway
    101349186
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101349186
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101349186
   04550 Signaling pathways regulating pluripotency of stem cells
    101349186
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101349186
   04657 IL-17 signaling pathway
    101349186
   04662 B cell receptor signaling pathway
    101349186
   04062 Chemokine signaling pathway
    101349186
  09152 Endocrine system
   04910 Insulin signaling pathway
    101349186
   04917 Prolactin signaling pathway
    101349186
   04935 Growth hormone synthesis, secretion and action
    101349186
   04919 Thyroid hormone signaling pathway
    101349186
   04916 Melanogenesis
    101349186
  09156 Nervous system
   04728 Dopaminergic synapse
    101349186
   04722 Neurotrophin signaling pathway
    101349186
  09158 Development and regeneration
   04360 Axon guidance
    101349186
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101349186
  09162 Cancer: specific types
   05210 Colorectal cancer
    101349186
   05225 Hepatocellular carcinoma
    101349186
   05226 Gastric cancer
    101349186
   05217 Basal cell carcinoma
    101349186
   05215 Prostate cancer
    101349186
   05213 Endometrial cancer
    101349186
   05224 Breast cancer
    101349186
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101349186
   05020 Prion disease
    101349186
   05022 Pathways of neurodegeneration - multiple diseases
    101349186
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101349186
   04931 Insulin resistance
    101349186
   04934 Cushing syndrome
    101349186
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101349186
  09172 Infectious disease: viral
   05160 Hepatitis C
    101349186
   05162 Measles
    101349186
   05163 Human cytomegalovirus infection
    101349186
   05167 Kaposi sarcoma-associated herpesvirus infection
    101349186
   05165 Human papillomavirus infection
    101349186
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101349186
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     101349186
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   101349186
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101349186
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 101349186
NCBI-ProteinID: XP_004373709
UniProt: A0A2Y9DFM9
LinkDB
Position
Unknown
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagtaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaggaagtcagctatacagacactaaa
gtgattggaaatgggtcgtttggtgtggtatatcaggctaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaaaagatttaagaaccgagagctccagatt
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagcggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgcttccagtgatctatgtcaagttg
tatatgtatcaactgttccgaagtttagcctatatccattcatttggaatctgccatcgg
gatattaaaccacagaacctcttactggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgtg
tggtctgcaggctgtgtgttggctgaactgttgctaggacaaccaatatttccaggagac
agtggtgtggatcaattggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaatccaaattacacagaattcaaattccctcaaattaaggcacatcct
tggacaaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cggactccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaaccgcc
cgattgacgccactggaagcttgcgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggccaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagacgctaatgctggagaccgtggacag
accaataacgccgcttctgcttcagcttccaactccacctga

DBGET integrated database retrieval system