KEGG   Trichechus manatus latirostris (Florida manatee): 101349290
Entry
101349290         CDS       T05135                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00230  Purine metabolism
tmu01100  Metabolic pathways
tmu01522  Endocrine resistance
tmu04015  Rap1 signaling pathway
tmu04020  Calcium signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04114  Oocyte meiosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04270  Vascular smooth muscle contraction
tmu04371  Apelin signaling pathway
tmu04540  Gap junction
tmu04611  Platelet activation
tmu04713  Circadian entrainment
tmu04714  Thermogenesis
tmu04723  Retrograde endocannabinoid signaling
tmu04724  Glutamatergic synapse
tmu04725  Cholinergic synapse
tmu04727  GABAergic synapse
tmu04740  Olfactory transduction
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04911  Insulin secretion
tmu04912  GnRH signaling pathway
tmu04913  Ovarian steroidogenesis
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04918  Thyroid hormone synthesis
tmu04921  Oxytocin signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04925  Aldosterone synthesis and secretion
tmu04926  Relaxin signaling pathway
tmu04927  Cortisol synthesis and secretion
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu04962  Vasopressin-regulated water reabsorption
tmu04970  Salivary secretion
tmu04971  Gastric acid secretion
tmu04972  Pancreatic secretion
tmu04976  Bile secretion
tmu05032  Morphine addiction
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101349290
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101349290
   04371 Apelin signaling pathway
    101349290
   04020 Calcium signaling pathway
    101349290
   04072 Phospholipase D signaling pathway
    101349290
   04024 cAMP signaling pathway
    101349290
   04022 cGMP-PKG signaling pathway
    101349290
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101349290
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101349290
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101349290
   04062 Chemokine signaling pathway
    101349290
  09152 Endocrine system
   04911 Insulin secretion
    101349290
   04923 Regulation of lipolysis in adipocytes
    101349290
   04912 GnRH signaling pathway
    101349290
   04913 Ovarian steroidogenesis
    101349290
   04915 Estrogen signaling pathway
    101349290
   04914 Progesterone-mediated oocyte maturation
    101349290
   04921 Oxytocin signaling pathway
    101349290
   04926 Relaxin signaling pathway
    101349290
   04935 Growth hormone synthesis, secretion and action
    101349290
   04918 Thyroid hormone synthesis
    101349290
   04928 Parathyroid hormone synthesis, secretion and action
    101349290
   04916 Melanogenesis
    101349290
   04925 Aldosterone synthesis and secretion
    101349290
   04927 Cortisol synthesis and secretion
    101349290
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101349290
   04270 Vascular smooth muscle contraction
    101349290
  09154 Digestive system
   04970 Salivary secretion
    101349290
   04971 Gastric acid secretion
    101349290
   04972 Pancreatic secretion
    101349290
   04976 Bile secretion
    101349290
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101349290
  09156 Nervous system
   04724 Glutamatergic synapse
    101349290
   04727 GABAergic synapse
    101349290
   04725 Cholinergic synapse
    101349290
   04723 Retrograde endocannabinoid signaling
    101349290
  09157 Sensory system
   04740 Olfactory transduction
    101349290
   04750 Inflammatory mediator regulation of TRP channels
    101349290
  09149 Aging
   04211 Longevity regulating pathway
    101349290
   04213 Longevity regulating pathway - multiple species
    101349290
  09159 Environmental adaptation
   04713 Circadian entrainment
    101349290
   04714 Thermogenesis
    101349290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101349290
  09165 Substance dependence
   05032 Morphine addiction
    101349290
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101349290
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101349290
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101349290
   05163 Human cytomegalovirus infection
    101349290
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101349290
Enzymes [BR:tmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101349290
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 101349290
NCBI-ProteinID: XP_004377624
UniProt: A0A2Y9DMW8
LinkDB
Position
Unknown
AA seq 1144 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVIMCAVVFSKDMLAPLVVAGIGLVLDII
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFAQAHAASDTVGWQAFFVFSFF
ITLPLSLSPIAIISVVSCVVHTLVLGVTVAQQQQDRLKGIQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMESGGIPGRVHISQSTMDCLKGEFDVEPGNGGSRCD
YLDEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPPSSKPSSPALIETKEPSGNTTS
SMSEEAEEHDTQTDNPSFPNPRQRLHLQDLADRVVDASEDEHELNQLLNEALLERESAQV
VKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPGLMTNYV
TFVVGEILLLVLTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMANVV
DMLSCLQYYTGPSNRTAGIVEEQDGCMANPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVAIINLYAWCPIFDEYDHRRFQEHEVPIITLEKMQVFSTPGLNGTNRLPLMPSKY
SMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRIITKIKTIGSTYMAASGVTPDVNTNGFTGSNKEEKSEKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAFPNGSSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgcctcggaaccagggcttctccgagcccgagtactcggctgagtattcagccgagtac
tctgtcagcctgccctctgacccggaccgcggtgtgggccggacccatgaaatctccgtc
cgaaactcggggtcctgcctctgcctgcctcgcttcatgcggttgaccttcgtgcccgag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggttttcgcagccctcttcgactgctacgtggtgatcatgtgtgccgtggtcttc
tccaaagacatgctggcgcccctcgtcgtggccgggattgggctagtgttggacatcatc
ctcttcgtgctctgtaaaaaggggctgctccctgaccgggtcacccgcaaagtggtgccc
tacctgctgtggctgctgataacagcccagatcttctcctacctgggtctgaactttgcc
caagcccacgcggccagcgacacagtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgcgatcatctctgtggtctcctgcgttgta
cacacactcgtcttgggggtcaccgtggcccagcaacagcaggaccggctaaaggggatc
cagttgctgagggagatcctggccaacgtcttcctctacctgtgcgccatcatcgtgggc
atcatgtcttactatatggcagaccgcaagcaccgcaaggccttcctggaggctcgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggaaaaccttatgctt
tccatcttgcccaagcacgtggctgacgagatgttgaaggacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacatcgtgggcttcacccagctgtcctctgcctgcagcgcccaggagcta
gtgaagctgctcaacgagctcttcgcccgctttgacaagttggcggcgaaatatcaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtggcctgcctgactaccgg
gaagaccacgctgtctgctccatcctcatggggctagccatggtagaggccatctcgtat
gtacgggagaagacaaagaccggggtggacatgcgtgtgggggtccacacgggcactgtg
ctgggcggcgtcctgggccagaagcgctggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggagtcaggcggcatcccggggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagtttgacgtggagccaggtaatggaggcagccgctgtgat
tacctagatgagaaaggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccaaaatggcctcaatggctcggccctgccaaatggagcaccaccttcc
tcaaagcccagctctcctgccctcatcgagaccaaggagcccagtgggaacaccaccagc
tctatgtcggaggaagccgaggagcatgacacccagacagacaacccctcattccccaac
ccccgtcagaggctgcaccttcaggacttggctgatcgcgtggtggatgcctctgaggac
gagcatgagctcaaccagctgctcaatgaggccctgctggagcgagagtctgcccaggta
gtaaagaaaagaaacacgttcctcctgtctatgcggttcatggaccctgagatggaaacc
cgctactcagtggagaaggaaaagcagagtggggccgccttcagctgctcctgcgttgtc
ctgctctgtacggcattggtcgagatactcatcgaccccgggctaatgacaaactatgtg
acctttgtggttggggagattctgctcctggtcctgacaatctgctcgctggctgccatc
tttccccgggcctttcctaagaagctcgtggccttctcgacgtggattgaccggactcgc
tgggccaggaacacctgggccatgttagccatcttcattctggttatggcaaacgttgtg
gacatgcttagctgtctccagtactacacggggcccagcaacaggactgcagggatagtg
gaggagcaggatggctgcatggcgaaccccaagtattacaactatgttgctgtgctgtcc
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatgctg
ctcgtcacgggcgcggtggccattatcaacctctatgcctggtgccccatctttgatgaa
tacgaccacagacgttttcaggagcatgaggttcccatcatcaccttagagaagatgcag
gtattttccactcctgggctcaatgggaccaataggctgcccctgatgccttctaagtac
tcgatgacagtgatgatgttcgtcatgatgctgagcttttactacttctcccgccatgtg
gaaaaactggcacggaccctgttcttgtggaagattgaggtccatgaccagaaggaacgt
gtttatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcccgccatttcctgggttccaagaagagagatgaggagctgtacagccagtcttacgat
gagatcggagtcatgtttgcctccctgcccaactttgctgacttctacacggaggagagt
atcaataacggtggcattgagtgtctgcgcttcctcaatgagatcatctcagattttgac
tctctcctggacaatcccaaattccggatcattaccaagatcaaaaccattggcagtacc
tacatggcagcttcaggagtcaccccagatgtcaataccaacggttttactggctccaac
aaggaagaaaagtcagagaaggagcgctggcagcacctggccgatctggctgactttgca
ctggccatgaaggacacgcttacaaacatcaacaaccagtccttcaacaacttcatgctg
cgcataggcatgaacaaaggcggggtactggctggcgtcattggagcccggaaaccacac
tatgacatctggggcaatacagtcaacgtagccagcaggatggagtccacaggggtcatg
ggcaacattcaggtagtggaagaaacacaagccattctccgagagtacggcttccgcttc
gtgaggcgaggtcctatctttgtgaaggggaagggggagctgctgacctttttcctgaag
gggcgtgataagccagctgccttccctaatggctcctctgtcacactgccccaccaggtg
gtggacaactcctga

DBGET integrated database retrieval system