KEGG   Trichechus manatus latirostris (Florida manatee): 101349359
Entry
101349359         CDS       T05135                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1 isoform X1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03420  Nucleotide excision repair
tmu04066  HIF-1 signaling pathway
tmu04110  Cell cycle
tmu04114  Oocyte meiosis
tmu04120  Ubiquitin mediated proteolysis
tmu04141  Protein processing in endoplasmic reticulum
tmu04310  Wnt signaling pathway
tmu04350  TGF-beta signaling pathway
tmu04710  Circadian rhythm
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101349359
   04120 Ubiquitin mediated proteolysis
    101349359
  09124 Replication and repair
   03420 Nucleotide excision repair
    101349359
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101349359
   04350 TGF-beta signaling pathway
    101349359
   04066 HIF-1 signaling pathway
    101349359
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101349359
   04114 Oocyte meiosis
    101349359
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    101349359
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101349359
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101349359
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101349359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tmu04121]
    101349359
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101349359
Enzymes [BR:tmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     101349359
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101349359
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     101349359
   ECV complex
     101349359
   Cul3 complex
     101349359
   Cul4 complex
     101349359
   Cul7 complex
     101349359
   Cul9 complex
     101349359
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      101349359
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      101349359
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 101349359
NCBI-ProteinID: XP_004373950
UniProt: A0A2Y9DGI8
LinkDB
Position
Unknown
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagccaaccag
gcgtctgctacttcagaagagtgtaccgttgcatggggagtctgtaaccatgcttttcat
ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccgttggacaacagagag
tgggaattccaaaagtatgggcactag

KEGG   Trichechus manatus latirostris (Florida manatee): 101350591
Entry
101350591         CDS       T05135                                 

Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04114  Oocyte meiosis
tmu04120  Ubiquitin mediated proteolysis
tmu04141  Protein processing in endoplasmic reticulum
tmu04310  Wnt signaling pathway
tmu04350  TGF-beta signaling pathway
tmu04710  Circadian rhythm
tmu05132  Salmonella infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101350591
   04120 Ubiquitin mediated proteolysis
    101350591
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101350591
   04350 TGF-beta signaling pathway
    101350591
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101350591
   04114 Oocyte meiosis
    101350591
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    101350591
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350591
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101350591
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101350591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tmu04121]
    101350591
   03036 Chromosome and associated proteins [BR:tmu03036]
    101350591
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     101350591
   Cul7 complex
     101350591
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     101350591
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101350591
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 101350591
NCBI-ProteinID: XP_004384776
UniProt: A0A2Y9E0X8
LinkDB
Position
Unknown
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcaattaagttgcagagttctgatggagagatatttgaagttgatgtggaaatt
gccaaacaatctgtgactatcaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcctctaccaaatgttaatgcagcaatattaaaaaaggtcattcag
tggtgcacccatcacaaggatgaccctcctcctcctgaggatgatgagaacaaagaaaag
agaacagacgacatccctgtttgggaccaagaattcctgaaagttgaccagggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgctaatatgatcaaggggaaaactcctgaggagattcgcaagactttcaat
atcaaaaatgactttactgaagaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagaaaagtga

KEGG   Trichechus manatus latirostris (Florida manatee): 101360163
Entry
101360163         CDS       T05135                                 

Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04114  Oocyte meiosis
tmu04120  Ubiquitin mediated proteolysis
tmu04141  Protein processing in endoplasmic reticulum
tmu04310  Wnt signaling pathway
tmu04340  Hedgehog signaling pathway
tmu04350  TGF-beta signaling pathway
tmu04710  Circadian rhythm
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101360163
   04120 Ubiquitin mediated proteolysis
    101360163
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101360163
   04340 Hedgehog signaling pathway
    101360163
   04350 TGF-beta signaling pathway
    101360163
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101360163
   04114 Oocyte meiosis
    101360163
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    101360163
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360163
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101360163
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tmu04121]
    101360163
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     101360163
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 101360163
NCBI-ProteinID: XP_004382415
UniProt: A0A2Y9DW63
LinkDB
Position
Unknown
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcgaaccggagccagaacccccatgggctgaaacagattggtctggatcagatc
tgggacgacctccgagctggcatccagcaggtctacaccaggcagagtatggccaagtcc
aggtacatggagctctacacccacgtgtacaactactgtacgagcgtgcaccagtcaaac
caggctaggggggccggcgtccctccctccaagtcgaagaagggacagacgcctggagga
gcccagtttgttggcttggaactgtacaaacggcttaaggagtttttgaagaattacttg
acaaatcttcttaaggatggagaagacttgatggatgagagcgtcctcaagttctacact
cagcagtgggaagactatcgattttctagcaaagtgctgaatgggatctgcgcctacctc
aaccgacactgggtccgccgtgagtgtgacgaaggacggaaaggaatctatgagatctat
tcacttgcgttggtgacttggagagactgtctcttcaggccgttgaataaacaggtaaca
aatgctgttttgaaactgatcgagaaggaaaggaatggtgaaaccatcaataccagactg
atcagtggagttgtacagtcttatgtggaattgggactgaatgaagatgacgcattcgca
aagggccctacgctaaccgtgtataaggagtcctttgaatctcagtttctggctgacaca
gagcgattttacacgagagagagtactgaattcttgcagcagaaccccgttacagaatat
atgaaaaaggctgaggctcgactgctggaggagcaacgccgcgttcaggtgtacctgcac
gagagcacgcaggatgagctggcacgcaagtgtgagcaggtgctcattgagaagcacctg
gagatcttccacacagagttccagaacctgctggatgccgacaagaatgaagatctgggc
cgcatgtacaacctcgtgtccaggatccaggacggcctgggggagctgaagaagctcctg
gagacacacatccacaaccagggtctcgctgcgattgagaagtgtggagaagccgcgtta
aacgaccccaaaatgtatgtgcagaccgttctggatgtgcacaagaagtacaacgccctg
gtaatgtccgccttcaacaacgatgctggcttcgtggccgcgcttgataaggcctgtggc
cgcttcatcaacaacaacgcggtgaccaagatggcacagtcatccagcaagtccccagag
ctgctggcgcgctactgcgactctttgctgaagaaaagctccaagaacccagaagaggca
gagctggaagacacgctgaaccaagtgatggtcgtcttcaagtacatcgaggacaaggac
gtcttccagaagttctatgcaaagatgctggccaagcgcctggtgcaccagaacagcgcg
agcgacgacgccgaggctagcatgatctccaagctgaagcaagcctgtggctttgagtac
acctccaagctccagcgcatgttccaggacatcggcgtgagcaaggacctgaacgagcag
ttcaagaagcacctgaccaactcagagcccctcgacttggacttcagcatccaggtcctg
agctccgggtcctggcccttccagcagtcctgcaccttcgcgctgccctcggagctggag
cggagttaccagcggttcacagccttctacgccagccggcacagtggcagaaagttgaca
tggctatatcagctgtccaaaggggaattggtaaccaactgtttcaagaacagatacacc
ttgcaggcatcaacgttccagatggcaatcctgctgcagtacaacacagaggatgcctac
accgtccagcagctgaccgacagcacgcagatcaaaatggacattctggcacaagtccta
cagattttattgaagtcaaagttattggtcttggaggacgaaaatgcgaatgttgatgag
gtggaactgaagccagacaccttaataaaattatatcttggttataaaaataagaaatta
agggttaacatcaacgtgccgatgaaaaccgaacagaagcaagaacaagaaaccacacac
aaaaatatcgaggaagaccgcaaactgctgattcaggcggccatcgtgagaatcatgaag
atgaggaaggtcctgaagcaccagcagctgctcggggaggtgctgacgcagctgtcgtcg
cgtttcaagccgcgggtccctgtcatcaagaaatgcattgatattctgattgagaaagaa
tatttggagcgagtggacggtgaaaaggacacctacagctacctggcttag

DBGET integrated database retrieval system