KEGG   Trichechus manatus latirostris (Florida manatee): 101349408
Entry
101349408         CDS       T05135                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04120  Ubiquitin mediated proteolysis
tmu04144  Endocytosis
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04625  C-type lectin receptor signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101349408
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101349408
   04151 PI3K-Akt signaling pathway
    101349408
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101349408
  09143 Cell growth and death
   04110 Cell cycle
    101349408
   04115 p53 signaling pathway
    101349408
   04218 Cellular senescence
    101349408
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101349408
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101349408
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101349408
   05202 Transcriptional misregulation in cancer
    101349408
   05206 MicroRNAs in cancer
    101349408
   05205 Proteoglycans in cancer
    101349408
   05203 Viral carcinogenesis
    101349408
  09162 Cancer: specific types
   05214 Glioma
    101349408
   05220 Chronic myeloid leukemia
    101349408
   05218 Melanoma
    101349408
   05219 Bladder cancer
    101349408
   05215 Prostate cancer
    101349408
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101349408
   05169 Epstein-Barr virus infection
    101349408
   05165 Human papillomavirus infection
    101349408
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101349408
   01522 Endocrine resistance
    101349408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101349408
   04121 Ubiquitin system [BR:tmu04121]
    101349408
Enzymes [BR:tmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101349408
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101349408
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101349408
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 101349408
NCBI-ProteinID: XP_012413845
UniProt: A0A2Y9G037
LinkDB
Position
Unknown
AA seq 498 aa
MVRSRQMCNTNMSVSATDGAAASTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKE
VIFYLGQYIMAKRLYDEKQQHMVYCSNDLLGDLFGEPSFSVKDHRKIYTMIYRNLVVVNQ
QEPLNSGTSVSENSCQLEDGNDQKDSVQELQEEKPSSSNLISRPTTSSRRRAISETEENS
DELASEGQRKRHRSDSVSLSFDESVALCVIREICCERSSSSDSTETPSNPDLDAGVSEHS
GDWLDQDSVSDQFSVEFEVESLDSEDYNLSEEGQELSDEDDEVYRVTVYQAEESDTDSFE
DDPEISLADYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKRKDKEKTHESAKLENTVQ
VEEGFDVPDCKKTTVNDSKESCVEENDDKITQASHSQESEDYSQPSTSSSIIYSSQDVRE
FEREETQGKEESVESRYRPIATEPCVICQDRPKNGCIVHGKTGHLMACFTCAKKLKKRNK
PCPVCRQPIQMIVLTYFL
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggtgagaagcaggcagatgtgcaataccaacatgtctgtgtctgctaccgatggtgct
gctgcaagcacctcacagattcctgcttcagaacaagagaccctggttagaccaaagcca
ttgcttttgaagttgttaaagtctgttggtgcacaaaaagacacttacactatgaaagag
gttatattttatcttggccaatatattatggctaaacgattatatgatgagaagcaacaa
catatggtatattgttcaaatgatcttctgggggatttgtttggtgagccaagcttctct
gtgaaagaccacaggaaaatatatacgatgatctacagaaacttggtagtagtcaatcag
caggagccattgaattctggcacatctgtgagtgaaaatagttgtcagcttgaagatgga
aatgatcaaaaggactctgtgcaagagttacaggaagagaaaccttcatcttcaaatttg
atttctagaccaactacctcatctagaaggagagcaatcagtgagacagaagaaaattca
gatgaattagccagtgaaggacaaagaaagcgccacagatccgatagtgtttccctttcc
tttgatgaaagcgttgcgctgtgtgtaataagggagatatgttgtgaaagaagcagtagc
agtgactcaacagaaaccccatcaaatccggatcttgatgctggtgtaagtgaacattct
ggtgattggttggaccaggattcagtttcagatcaattcagtgtagaatttgaagttgaa
tctcttgattcagaagattataaccttagtgaggaaggacaagagctctcagatgaagat
gatgaggtgtatcgagttactgtctatcaggcagaggagagtgatacagattcatttgaa
gatgatcctgaaatttccttagctgactattggaagtgcacttcatgcaatgaaatgaac
cctcctcttccaccgcattgtaacagatgttgggcacttcgtgagaattggcttcctgaa
gataagaggaaagataaagagaagacgcatgagagtgctaaactagaaaacacagtgcag
gtagaagagggctttgatgttcctgattgtaaaaaaacgacagtgaatgactccaaagag
tcatgtgttgaggaaaatgatgataaaataacacaagcttcccattctcaagaaagtgag
gactattctcagccatcaacttccagtagcatcatttatagcagccaagatgtcagagag
tttgagagggaagaaacacaaggcaaagaagaaagtgtggaatctagatatcgccctatt
gcaactgaaccttgtgtgatttgccaagatcgacctaaaaatggttgcatcgtccacggc
aaaacaggacatcttatggcatgctttacatgtgcaaagaagctaaaaaaaagaaataag
ccctgcccagtatgtagacaaccaattcaaatgattgtgttaacttatttcctctag

DBGET integrated database retrieval system