KEGG   Trichechus manatus latirostris (Florida manatee): 101349720
Entry
101349720         CDS       T05135                                 

Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03030  DNA replication
tmu03410  Base excision repair
tmu03420  Nucleotide excision repair
tmu03430  Mismatch repair
tmu04110  Cell cycle
tmu04530  Tight junction
tmu05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101349720
   03410 Base excision repair
    101349720
   03420 Nucleotide excision repair
    101349720
   03430 Mismatch repair
    101349720
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101349720
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101349720
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101349720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tmu03032]
    101349720
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101349720
DNA replication proteins [BR:tmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    101349720
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101349720
   MMR (mismatch excision repair)
    Other MMR factors
     101349720
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    101349720
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 FmdE
Other DBs
NCBI-GeneID: 101349720
NCBI-ProteinID: XP_004383101
UniProt: A0A2Y9DXS9
LinkDB
Position
Unknown
AA seq 261 aa
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSSDVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgttcgaggcgcgcttggtccagggctccatcctgaagaaagtgctagaggcgctcaag
gacctcatcaacgaggcctgctgggacatcagctcgagcggcgtgaacctgcagagtatg
gactcgtcccacgtctccttggtgcagctcaccctgcgctctgagggctttgacacctac
cgctgcgaccgtaacctggccatgggtgtgaatctcaccagcatgtccaaaatactaaaa
tgtgctggcaacgaagacatcattacactaagggccgaagataatgcggataccttggca
ctagtattcgaagcaccaaaccaagaaaaagtttcagactatgaaatgaagttaatggat
ttagatgttgaacaacttggaattccagaacaggagtatagctgtgtagtaaagatgccg
tctggtgaatttgcacgtatatgccgagatctcagtcatattggagatgctgttgtcatt
tcctgtgcaaaagatggagtgaaattttctgcaagtggagaacttggaaatggaaacatt
aagttgtcacaaacaagtaatgttgataaagaggaggaggctgttaccatagagatgaat
gagccagttcagctaacttttgcacttaggtacctgaacttctttacaaaagccactcct
ctctctcctacagtaacactcagtatgtcttcagatgtgccccttgttgtagagtataaa
attgctgatatgggacacttaaagtactatctggctcccaagatcgaggatgaagaagga
tcttag

DBGET integrated database retrieval system