KEGG   Trichechus manatus latirostris (Florida manatee): 101349786
Entry
101349786         CDS       T05135                                 

Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04110  Cell cycle
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04310  Wnt signaling pathway
tmu04350  TGF-beta signaling pathway
tmu04390  Hippo signaling pathway
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04630  JAK-STAT signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu05132  Salmonella infection
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05213  Endometrial cancer
tmu05216  Thyroid cancer
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101349786
   04012 ErbB signaling pathway
    101349786
   04310 Wnt signaling pathway
    101349786
   04350 TGF-beta signaling pathway
    101349786
   04390 Hippo signaling pathway
    101349786
   04630 JAK-STAT signaling pathway
    101349786
   04151 PI3K-Akt signaling pathway
    101349786
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101349786
   04218 Cellular senescence
    101349786
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101349786
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101349786
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101349786
   05202 Transcriptional misregulation in cancer
    101349786
   05206 MicroRNAs in cancer
    101349786
   05205 Proteoglycans in cancer
    101349786
   05230 Central carbon metabolism in cancer
    101349786
  09162 Cancer: specific types
   05210 Colorectal cancer
    101349786
   05225 Hepatocellular carcinoma
    101349786
   05226 Gastric cancer
    101349786
   05216 Thyroid cancer
    101349786
   05221 Acute myeloid leukemia
    101349786
   05220 Chronic myeloid leukemia
    101349786
   05219 Bladder cancer
    101349786
   05213 Endometrial cancer
    101349786
   05224 Breast cancer
    101349786
   05222 Small cell lung cancer
    101349786
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101349786
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101349786
   05161 Hepatitis B
    101349786
   05160 Hepatitis C
    101349786
   05163 Human cytomegalovirus infection
    101349786
   05167 Kaposi sarcoma-associated herpesvirus infection
    101349786
   05169 Epstein-Barr virus infection
    101349786
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101349786
   03019 Messenger RNA biogenesis [BR:tmu03019]
    101349786
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    101349786
Messenger RNA biogenesis [BR:tmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101349786
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 101349786
NCBI-ProteinID: XP_023583962
UniProt: A0A2Y9QX77
LinkDB
Position
Unknown
AA seq 438 aa
MPLNVSFANRNYDLDYDSVQPYFFDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPL
SPSRRSGLCSPSYNLAFASFSPGGGGGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDD
ENLIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGHGGCSTSSLYLQDL
SAAASECIDPSVVFPYPLNDGSSPKACASPDSTAFSSSSDSLLSSVESSPRASPEPRALH
EETPPTTSSDSEEEQEDDEEIDVVSVEKRQPPAKRSEAGSHSSGGHSKPPHSPLVLKRCH
VSTHQHNYAAPPSTRKDYPATKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHNV
LERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEQKLISEKDLLR
KRREQLKHKLEQLRNSCE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctggactatgactcagtgcaa
ccgtatttcttcgacgaggaggagaacttctatcagcagcagcagcagagcgagctgcag
ccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgcccctg
tccccaagccgccgctccgggctctgctcgccctcctacaacctggccttcgcgtccttc
tcccccggaggaggcggcggcggcggcggcagcttttccaccgccgaccagttggagatg
gtgaccgagctgctggggggagatatggtgaaccagagcttcatctgcgacccggacgac
gagaacctcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggccgcg
gccaagctggtctcggagaagctggcctcctatcaggctgcgcgcaaagacagcggcagc
ccgagccccgcccgcggccacggcggctgctccacctccagtctctacctgcaagacctg
agcgctgccgcctccgagtgcatcgacccctcggtggtcttcccctacccactgaacgac
ggcagctcgcccaaggcctgcgcctcgccggactccaccgccttctcctcgtcctcggac
tctctgctctcctccgtggagtcctccccacgggccagccccgagccccgggcgctccac
gaagagacaccccccacgaccagcagcgactctgaggaagaacaagaagatgacgaagaa
atcgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaagcggggtca
cactcttccggaggccacagcaaacctcctcacagtccgctggtcctcaagcgatgccat
gtctccacccatcagcacaactacgcagccccaccctccaccaggaaggactaccccgcc
accaagagggcgaagttggacagtggcagagtcctgaaacagatcagcaacaaccgcaaa
tgtgccagccccaggtcttcagacacggaggagaacgacaagaggcggacacacaacgtc
ttggaacgccagaggaggaacgagctgaaacggagcttttttgcccttcgagaccagatc
ccagagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcg
tacatcttgtctatccaagcagaggagcaaaagctcatttcagaaaaggacttgttgcgg
aaacgccgagaacagttgaaacacaaacttgaacagctacggaactcttgtgaataa

DBGET integrated database retrieval system