KEGG   Trichechus manatus latirostris (Florida manatee): 101349908Help
Entry
101349908         CDS       T05135                                 

Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05164  Influenza A
tmu05202  Transcriptional misregulation in cancer
tmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    101349908
   05215 Prostate cancer
    101349908
  09167 Infectious diseases
   05164 Influenza A
    101349908
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tmu01002]
    101349908
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101349908
Peptidases [BR:tmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101349908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Trypsin_2 UL42
Motif
Other DBs
NCBI-GeneID: 101349908
NCBI-ProteinID: XP_023594890
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MALNSGSPAPYYENHGYQPANFYPPQPPGAPSAPPAYATPYYLSPVPEYVPRVLTQDSTP
VIRPQPKPPSPTVCSSKAKKALSITFTVVAVLSGVVLAAVLLWKFCECRGSWTLSAGGSW
SHSLWCGAVWCCVVCPSRTHEDSPSPTVRLYGPDFILQVFSAHRKSWHPVCWDDWSESYG
RAACRDMGYKQSFYSSQGVVDNSTATSFMKLNTSAGNIDLYKRLFHSDSCSLKRVVSLRC
IECGVTTKVTRESRIVGGKNASLGDWPWQVSLNVQGAHVCGGSIITPEWIVTAAHCVEEP
LSNPRYWTAFAGILKRSLMFYEYGYQVAKVISHPNYDSKTKNNDVALMKLQTPLTFNDRI
RPVCLPNPGMMLEPTQTCWISGWGATQEKGKTSDELNAAQVPLIEPWRCNKSYIYNNLIT
PAMICAGYLQGYVDSCQGDSGGPLVTLKNSVWWLIGDTSWGSGCAQANRPGVYGNVTVFT
DWIYQQMRANS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcagggtcaccagcaccttactatgaaaaccacgggtaccagccagcg
aacttctaccctccacagccccctggggctcccagtgcccccccagcgtacgcaaccccc
tactacctgtcccccgtgcccgagtacgtcccgagggttctgacgcaagattcgacgcca
gtcatccgcccgcagcccaagcccccatcgccgactgtatgctcctcaaaagccaagaaa
gcgctcagtatcaccttcacggtggtggctgtcctttccggcgtggtgctggccgctgtc
ctgctctggaagttttgtgagtgcagggggagctggaccctgagtgcgggggggagctgg
tctcacagtctgtggtgtggtgcggtgtggtgttgtgttgtctgtccctcacgcactcat
gaagactctccctctcccacagtgcgcctctacggacccgacttcatcctgcaggtgttc
tctgcccataggaagtcctggcaccccgtgtgttgggacgactggagtgagagctacgga
cgggcagcctgcagagacatgggctacaaacaaagtttctactccagccaaggcgtggtg
gacaacagcactgccaccagctttatgaagctgaacaccagcgccgggaacatcgacctc
tacaagaggctgttccatagtgattcttgttctttgaaaagagtggtgtctttacgctgt
atagagtgtggggtcaccaccaaggtaacccgcgagagccggatcgtggggggcaagaac
gccagcctgggggattggccctggcaggtcagcctgaatgtccaaggcgcccacgtctgt
ggaggctccatcatcacccctgagtggatcgtgacggccgcccactgtgtggaagagcct
ctttccaacccccggtactggacagcctttgcggggattttgaagcggtctttaatgttc
tatgaatatggataccaagtagcgaaagttatctctcatccaaattatgattccaagacc
aagaacaatgacgttgctcttatgaaattgcagacaccgctgacgtttaacgacagaata
aggcccgtgtgtctgcccaacccgggcatgatgctggagccgacgcagacctgctggatt
tctgggtggggcgccacccaggagaaagggaaaacctccgatgagctgaatgcagctcag
gtgccccttatcgagccctggaggtgtaacaagagctacatctacaacaacctcatcacc
cctgccatgatctgcgcggggtatctgcagggatacgttgactcctgccagggtgacagt
gggggccctctggtcactttgaagaacagtgtctggtggttgattggagacacgagctgg
ggatctggatgtgcccaggcaaacaggccaggcgtgtacggaaatgtgacagtattcaca
gactggatttaccaacaaatgagggccaatagctaa

DBGET integrated database retrieval system