KEGG   Trichechus manatus latirostris (Florida manatee): 101350583Help
Entry
101350583         CDS       T05135                                 

Definition
(RefSeq) probable maltase-glucoamylase 2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00052  Galactose metabolism
tmu00500  Starch and sucrose metabolism
tmu01100  Metabolic pathways
tmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101350583
   00500 Starch and sucrose metabolism
    101350583
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101350583
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101350583
    3.2.1.20  alpha-glucosidase
     101350583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 101350583
NCBI-ProteinID: XP_023592691
UniProt: A0A2Y9RGQ9
LinkDB All DBs
Position
Unknown
AA seq 1742 aa AA seqDB search
MEETLAPERFRLDGQTDAVEIVNGVLGQLERRGGVCEVCSWQRGCCWNPVEDTNVPKCFF
PKNWGYEVSNDRWNKSLVFSAQLKRLPSPTLFGNDVSDALFTAEYQTSNRLHFKITDFNN
RRYEVHHESISSLTQNDSISNTSYQVEVIKNPFSIKIMRTSNRKVLLDTGIGPLQFAQQY
LQLSFRLPSTNLYGLGEHVHQQYRHDMNWKTWPIFTRDTSPTEDGVNLYGAHTFFLCLED
ASGTSFGVFLMNSNAMEVTLQPAPAITYRTIGGVLDFYVFLGSTPEQVVQEYLELVGKPF
LPSYWSLGFQLSRRNYGGIEGLKKVVSRNRAAGIPYDVQYSDIDYMDGYKDFTYDNRTFY
GLPEFAKELHSNGQKYVIVMNPGIANHSGYKPYDDGKTKRIWVYQNDVFAVGKGYPGWTI
FPDFSNPVTSPWWTEQFEEFYKTLEFDGVWIEMDEVSNLLQGSDVGCESNSLNNPPFTPR
VLDRVLFEKTLCMDTEFYGGLHYDVHSVYGYSMAQATDSAMEAVFPNKRSLILSRSTFAG
SGKFAGHWLGDNTASWNDLRWSISSILEFNLFGIPMVGANICGYEEDTTESLCRRWMQLG
AFYPLSRNHNGPGFVDQDPAAFGADSLLVNSSRHYLNIRYTLLPYLYTLFYLAHTRGDTV
ARPLLHEFYQDPATWDVHEQFLWGPALLITPVLHADVDQVNAYIPDAIWYDYETGVAIQW
RKQQVQMQFPEDRIGLHLRGGYILPTQKPNTTTEASRKNSLGLIIALDHRREAKGELYWD
DGISKDAVTKENYLLYDFSVASVVTITDLQGLRLGHEFSIEWTLPVNDTEKFNCYPDDPS
ASEESCRQRGCLWEPTAAAGVPPCYYDTIPSYAASNIQYLPTGITADLTLLPDALNPSPT
VYLNRSPSARAADHLSARINSLQLSVVYHTESMLQFKIYSSTNRRYEVPVPLNIPAMPVG
SPEQRLYDVSIQTNPFGIQIRRRSSNTVIWDSQLPGFTFNDMFLSISTRLPSEYIYGFGE
TEHESFKRNTGWNTWGMFARDESPGYKRNSYGVHPYYMALEGNGSAHGVLLLNSNAMDVT
IQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPVMTPYWALGFQLSRYGYHND
TEISNLYDAMVAAQIPYDVQQVDMDYMERKLDFTLSPRFKDLAHLVDRMKKNGMRFIPIL
DPAISGNETGYLPFTRGQADNVFIKWPDSSDIVWGKAWPDLPNVNVDESLDHETQVKLYR
AHVAFPDFLRNSTVAWWKKEIQELYENPREPEKSLKFDGLWLDMNEPSNFVDGSVSGCQD
SILNNPPYMPSLESRDSGLSSKTLCMQSQQVLADGSLVRHYDVHSLYGWAQTRPTYEAVQ
QVTGQRGVVITRSTFPSSGRWAGHWLGGNTASWDQLRKSIIGMMEFSLFGMSYTGADICG
FFGNAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFENYSRSVLQTRYTLLPY
LYTLMHKAHVEGSTVVRPLLHEFADDTKTWEIDCQFMLGPAILISPVLENGTSAISAYFP
RARWYDYSTESGEESAGEQKILAAPLDHINLHVRGGYILPWQEPAMNTHYSRQNFMGLTV
ALDSDWKAHGQLFWDDGQSIDTYEKGNYFLANFTAAQDTLQIQTIHNNYLNDSNPLKVGY
IRIWGMKSAYVTEVRVNHDNKQFVETNFRSNPDNQYLLVLYFKTVVLDYWVHKHHFQVIA
CT
NT seq 5229 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaccctagctcctgagcgctttaggctggatgggcagacagatgcagtcgag
atagtgaatggtgtcttgggccaactggagaggagaggtggtgtgtgtgaagtctgcagc
tggcagcgtgggtgctgctggaatcctgtggaggataccaatgtccccaagtgcttcttt
cccaagaactggggctatgaagtcagcaatgaccgctggaacaaaagcctagtgttttct
gcccagttgaaaaggctgccatcgcccactctgtttggaaatgatgtcagcgacgccctc
ttcacagctgaatatcagacatccaatcgtttacattttaagatcactgatttcaataac
agacgatatgaagtccaccatgaaagcattagttcgctgactcagaatgatagtatctcc
aataccagctatcaagtggaggtcattaaaaaccccttcagcatcaaaataatgaggacg
agcaaccgaaaagtcttgttggacacgggcattgggcccctccagtttgcccagcagtac
ctgcagctgtctttccgcctgcccagcaccaacctgtacgggctgggggaacacgtgcac
cagcagtaccgccatgacatgaactggaagacctggcccatcttcactcgggacacctct
cccaccgaggatggcgttaatctctatggggctcatacattcttcttgtgccttgaagat
gccagtggcacctcgttcggggttttcctaatgaacagtaacgccatggaggtcaccctt
cagcctgctccggcaatcacctaccgcacaattgggggcgttcttgacttttacgtgttc
ctgggaagcactccagaacaggttgttcaggaatacctggagcttgttggcaaaccgttc
ttgccttcctactggagtttggggttccagcttagtcgcaggaattatggtggcatcgaa
ggattgaaaaaagttgtgagccgaaaccgtgcagctgggattccgtatgatgtgcagtac
tctgacatagactacatggatggatacaaggatttcacttatgacaataggactttctat
ggtctcccagagtttgccaaggagttacacagcaatggacagaaatatgtcattgttatg
aatcctggcatcgccaaccactctggctacaagccctatgatgatggaaaaacaaagagg
atatgggtctaccagaatgatgtgtttgctgttgggaagggctatcccgggtggacaatc
tttcctgatttcagtaatccagtgacctctccctggtggacagagcagttcgaggaattc
tataaaactctggagtttgatggagtgtggattgagatggatgaagtatctaaccttctc
caaggttctgatgttgggtgtgaatcaaacagcttgaacaatcctcctttcactcctaga
gttctggaccgtgtgctttttgagaaaaccctttgcatggacacagagttttatggtggc
cttcactatgacgtccacagcgtgtatggctattccatggcacaagccacagactcggcc
atggaggctgtcttccccaataaaaggagcctcatcttatcccgttctacttttgctggg
tctggcaagtttgctggtcactggttgggggacaacacggcctcgtggaatgacctccgg
tggtccatttccagtatccttgagttcaacctatttggcatccccatggtaggtgccaat
atctgtggttatgaagaagataccacagagagcctctgcagaagatggatgcagcttgga
gcattttatccactctccaggaatcacaatgggcctggcttcgtggaccaggaccccgcc
gcctttggagccgactccctgctggtcaactcctccaggcactatctgaacatccgttac
actttgctgccctacctgtacaccctcttctacctcgcccacacccgtggggacaccgtg
gcccggcccctgctgcatgagttctaccaggacccagccacctgggacgtgcacgagcag
ttcctatgggggcctgcactcctcatcacgcctgttttacatgccgatgtggaccaagtg
aatgcctacatcccggatgccatctggtatgactatgagacaggagtggccatccaatgg
aggaaacaacaggtgcagatgcagttccctgaagacagaataggacttcaccttcgagga
ggctacatactccccacccagaagccaaacacaaccacagaggccagccggaagaattcc
ctgggactcatcattgccttggatcataggagagaagctaagggggagctttactgggat
gatggcatatccaaagacgctgtgaccaaagagaactacctcctgtacgacttttctgtg
gcctctgtggtgaccatcactgacctccaggggctgagactgggacacgagttctccatt
gagtggacgcttcctgtcaatgacacggagaagttcaactgctaccctgatgatccctct
gcttcagaggagagctgcaggcagcgggggtgcctgtgggagcctacagctgccgctgga
gtgcccccctgttactacgacaccatccctagctatgctgccagtaacatccaatatctg
cctactggcatcaccgcagacctcaccctcctgccggatgccctgaatccctctccaaca
gtgtatctgaaccgatcaccctcggcccgcgcagctgatcatctctctgccaggatcaac
agcctccaactgagtgtggtgtaccacacagagagcatgctacagttcaagatctacagt
tccaccaacagaaggtacgaggtcccggtgcccctcaacatcccagccatgccagtgggc
tcccctgagcagcgtctctatgatgtcagtatccagaccaatccttttgggatccagatt
cgacggagaagctccaacacggtgatctgggactctcagcttcctggcttcaccttcaac
gacatgttcctctccatctcgactcgcctgccctccgagtacatctacggctttggggaa
actgagcatgaaagcttcaaaagaaacacgggctggaacacatggggaatgtttgctcga
gatgagtccccagggtacaagaggaactcctatggcgtgcacccctactacatggcgctg
gagggcaacggcagcgcccatggagtgctcctgctcaacagcaatgccatggatgtgacc
atccagcccacccctgccctgacataccgcaccacaggagggattttggacttttatatg
gttttgggaccaacccctgaacttgtaactcagcagtacaccgagctgattggccggcca
gtgatgactccatactgggccttgggattccagctgagtcgctatggataccacaatgat
acggagatctccaatttgtatgatgcgatggtggcagcccagatcccctacgatgtgcag
caggtggacatggactacatggagcggaagctggacttcactctcagccccaggttcaaa
gacctcgcccacctggttgatcgaatgaagaaaaatggcatgaggtttattcccattctg
gacccagccatttctggcaatgagaccgggtatctccccttcaccagggggcaggcagac
aacgtgttcatcaaatggccagacagcagtgacattgtctgggggaaggcttggccggat
ctgcccaatgttaatgtggatgaatccctcgaccatgagactcaggtgaagctgtacagg
gcccacgtggcatttcctgacttcctacgcaacagcacagttgcatggtggaagaaagaa
atacaagagctctatgaaaaccctcgagagccagagaagagcttgaagtttgatgggctg
tggcttgatatgaacgagccatcaaactttgtggatggatccgtcagcggctgccaggat
agcattctgaataacccgccctacatgccatctctggagtccagggacagcggcctgagc
agcaagacgctgtgcatgcagagccagcaggtgctggcggacggctccctggtgcggcac
tacgacgtgcacagcctgtacggctgggcccagaccaggcccacctacgaagctgtgcag
caggtgacagggcaacgaggtgttgtcatcacccgctccaccttcccctcctctggccgc
tgggcaggacactggctgggaggcaacacggcctcctgggaccagctgaggaaatccatc
atcggcatgatggagttcagcctctttggaatgtcctatacaggagcagacatatgtggc
ttctttggaaacgcggaatacgagatgtgcgtccgctggatgcagctgggggctttctac
cctttctccaggaaccacaacaccatcgggaccaggagacaagatcctgtgtcctgggat
gctgcctttgagaactactccaggagcgtcctgcagaccagatacaccctgctgccatac
ctctacaccctgatgcacaaggcccatgtcgagggcagcactgtcgtccggccccttctc
catgagtttgcagatgacactaagacctgggagatcgactgtcagttcatgctgggtccc
gccatcctgatcagccctgtgctggaaaatggtacttctgcgatctccgcttacttcccc
agagcccgctggtatgactacagcacggaatcaggtgaggagtcggcaggtgagcagaag
atcctggccgctccccttgaccacatcaaccttcacgtcagaggaggctacatcctgccc
tggcaagagcctgctatgaacactcactacagtcgacaaaattttatgggattgactgtt
gccttggacagtgactggaaagctcatggccagctgttctgggatgatggacaaagcatt
gatacctatgaaaaaggaaactatttcttggcaaactttacagcagctcaggataccttg
cagatccagaccatacacaataactatctgaatgactcgaatccactgaaggttggctat
attaggatctgggggatgaaatctgcttatgtgacagaagtcagggtcaaccatgacaac
aagcaatttgtggagacaaacttcaggagtaaccctgacaatcagtaccttctagttctc
tacttcaaaacagttgtcctggactattgggtccacaaacaccattttcaagtgattgct
tgtacttga

DBGET integrated database retrieval system