KEGG   Trichechus manatus latirostris (Florida manatee): 101350740
Entry
101350740         CDS       T05135                                 

Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04640  Hematopoietic cell lineage
tmu04916  Melanogenesis
tmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101350740
   04014 Ras signaling pathway
    101350740
   04015 Rap1 signaling pathway
    101350740
   04072 Phospholipase D signaling pathway
    101350740
   04151 PI3K-Akt signaling pathway
    101350740
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101350740
  09152 Endocrine system
   04916 Melanogenesis
    101350740
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tmu04052]
    101350740
Cytokines and growth factors [BR:tmu04052]
 Growth factors
  Growth factors (RTK binding)
   101350740
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 101350740
NCBI-ProteinID: XP_023594319
UniProt: A0A2Y9RQV6
LinkDB
Position
Unknown
AA seq 273 aa
MKKTQTWIFTCIYLQLLLFNPLVKTKGICGNRVTDDVKDVTKLVANLPKDYKISLKYVPG
MDILPSHCWISEMVRQLTFSLTELLSKFSSISEGLSNYSIIDKLVKIVDDLVECVEEHLS
TPVVRGSKNPEPRLFTPEEFFSIFNRSIDAIKDFRGTSETSDCVLSSTLSPEGDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAENSIDDSNLQWAAMAFLAFFSLVIGFAFGAFYWKQK
QPNLTRAVENRQISEEDNEISMLQEREREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattttcacttgcatttatcttcaactgctcctgtttaat
cctctcgtcaaaactaaagggatctgcgggaatcgtgtgactgatgatgtgaaagacgtt
acaaaactggtggcaaatcttccaaaagactataagatatccctcaagtatgttcccggg
atggacattttgcctagtcattgttggataagtgagatggtgagacaattgacattcagc
ttgactgagcttctgagcaagttttcaagtatttctgaaggcttgagtaattactctatt
atagacaaacttgtgaagatagtggatgatctggtggagtgcgtggaggaacacttatct
acgcctgtagtaagaggatctaagaacccagaacccaggctatttactcctgaagaattc
tttagcatttttaatagatccatagatgccatcaaggactttagggggacatctgaaaca
agtgattgtgtgctttcttcaacattaagtcctgagggagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggctgaaaattccattgacgattccaacctacaatgggcagccatggcattt
ctagcattcttttctcttgtaattgggtttgcgtttggagccttctactggaagcagaaa
caaccaaatcttacaagggcagttgaaaatagacagatcagtgaagaggataatgagata
agtatgttgcaagaaagagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system