KEGG   Trichechus manatus latirostris (Florida manatee): 101351589
Entry
101351589         CDS       T05135                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04068  FoxO signaling pathway
tmu04270  Vascular smooth muscle contraction
tmu04650  Natural killer cell mediated cytotoxicity
tmu04720  Long-term potentiation
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101351589
   04012 ErbB signaling pathway
    101351589
   04068 FoxO signaling pathway
    101351589
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101351589
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101351589
  09152 Endocrine system
   04910 Insulin signaling pathway
    101351589
   04914 Progesterone-mediated oocyte maturation
    101351589
   04928 Parathyroid hormone synthesis, secretion and action
    101351589
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101351589
  09156 Nervous system
   04726 Serotonergic synapse
    101351589
   04720 Long-term potentiation
    101351589
   04730 Long-term depression
    101351589
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101351589
   05205 Proteoglycans in cancer
    101351589
  09162 Cancer: specific types
   05210 Colorectal cancer
    101351589
   05212 Pancreatic cancer
    101351589
   05225 Hepatocellular carcinoma
    101351589
   05226 Gastric cancer
    101351589
   05214 Glioma
    101351589
   05221 Acute myeloid leukemia
    101351589
   05220 Chronic myeloid leukemia
    101351589
   05218 Melanoma
    101351589
   05211 Renal cell carcinoma
    101351589
   05219 Bladder cancer
    101351589
   05215 Prostate cancer
    101351589
   05213 Endometrial cancer
    101351589
   05224 Breast cancer
    101351589
   05223 Non-small cell lung cancer
    101351589
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101351589
   05022 Pathways of neurodegeneration - multiple diseases
    101351589
  09165 Substance dependence
   05034 Alcoholism
    101351589
  09172 Infectious disease: viral
   05161 Hepatitis B
    101351589
   05160 Hepatitis C
    101351589
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101351589
   01522 Endocrine resistance
    101351589
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101351589
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101351589
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101351589
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like TUG-UBL1 Pkinase_fungal
Other DBs
NCBI-GeneID: 101351589
NCBI-ProteinID: XP_023587655
UniProt: A0A2Y9QWB1
LinkDB
Position
Unknown
AA seq 611 aa
MELPRAPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRHFYHSVQDLSGVSRQHEAPSNRPLNEPL
TPPGPSLSPVSSCTQHRDLEHFPFLAPANVPLQRIRSTSTPNVHMVSTTAPTDSSLIQLT
AQSFSTDAAGTRGGGDGAHRRNPSPASMSSGRKSPHSKSPSEQRERKSLADEKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNSIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLVP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagctgccacgggcgccccctgccaatggggctgagccatcccgggcagtgggtacc
gtcaaagtctacctgcccaacaagcagcgcacggtggtgaccgtccgggatgggatgagt
gtctatgactctctagacaaggcccttaaggtgcggggtctcaatcaagactgctgcgtg
gtctaccgactcatcaaggggcgaaagacggtcactgcctgggacactgccattgccccc
ttggatggtgaggagctcattgtcgaggtccttgaagatgtcccactgaccatgcacaat
tttgtacggaagacattcttcagcctggcgttctgtgacttctgtcttaagtttctgttc
catggcttccgctgccaaacctgtggctataagttccatcagcattgttcctccaaggtg
ccaacagtctgtgtcgacatgagcaccaaccgccgacatttctaccacagtgtccaggat
ttgtcaggagtctccagacagcacgaggctccctcgaaccgtcccctgaatgagccgcta
acccccccaggtcccagcctttctcctgtcagctcctgcacccagcaccgcgacctggag
cacttccccttccttgccccggccaatgtccccctccagcgcatccgttccacatccact
cccaacgttcatatggtcagcaccacagcccccacagactccagcctcatccagctcact
gcccagagtttcagcactgatgctgctggtactagaggtggtggtgatggagcccaccgg
aggaaccccagcccggctagcatgtcctcggggaggaagtccccacattccaagtcacct
tcagagcagcgggagcggaagtccttggctgatgagaagaagaaagtgaagaacctgggg
taccgagattcaggctattactgggaggtgccacccagtgaagtacagctgctgaagagg
attggaacgggctcatttggcactgtgtttcgtgggcggtggcatggtgatgtggctgtg
aaggtgctcaaggtggctcagcccacagctgagcaggcccaggccttcaagaacgagatg
caggtgctcaggaagacacggcacgtcaacatcttgctgtttatgggcttcatgacccgg
ccaggattcgccatcatcacacagtggtgcgagggctccagcctctaccaccatctacat
gtggctgacacacgcttcgacatggttcagctcatcgatgtggcccggcagactgcccag
ggcatggactacctccatgccaagaacatcatccaccgagatctcaagtctaacagtatc
ttcctacatgaggggctcacagtaaagattggtgacttcggcctggccacggtgaagacg
cggtggagcggagcccagcccttggagcagccctcgggctccgttctatggatggctgct
gaggtgatccggatgcaggacccgaacccctacagcttccagtcagatgtctacgcctat
ggggttgtgctgtatgaactcatgactggctcactgccttatagccacattggcagccgt
gaccagattatctttatggttggccgtggctatctgtccccggacctcagcaaaatctcc
agcaactgccccaaggccatgcgtcgcctgctatctgactgcctcaagttccagcgggag
gagcgacccctcttcccccagatcctggccacgattgagctgctgcagcggtcactcccc
aagattgagaggagtgcctccgaaccctccttgcaccgcacccaggctgatgagttgcct
gcctgcctgctcagcgcagcccgccttgtgccttag

KEGG   Trichechus manatus latirostris (Florida manatee): 101353421
Entry
101353421         CDS       T05135                                 

Definition
(RefSeq) serine/threonine-protein kinase B-raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04015  Rap1 signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04068  FoxO signaling pathway
tmu04150  mTOR signaling pathway
tmu04270  Vascular smooth muscle contraction
tmu04510  Focal adhesion
tmu04650  Natural killer cell mediated cytotoxicity
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04934  Cushing syndrome
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101353421
   04012 ErbB signaling pathway
    101353421
   04015 Rap1 signaling pathway
    101353421
   04068 FoxO signaling pathway
    101353421
   04024 cAMP signaling pathway
    101353421
   04150 mTOR signaling pathway
    101353421
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101353421
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101353421
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101353421
   04062 Chemokine signaling pathway
    101353421
  09152 Endocrine system
   04910 Insulin signaling pathway
    101353421
   04914 Progesterone-mediated oocyte maturation
    101353421
   04928 Parathyroid hormone synthesis, secretion and action
    101353421
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101353421
  09156 Nervous system
   04726 Serotonergic synapse
    101353421
   04720 Long-term potentiation
    101353421
   04730 Long-term depression
    101353421
   04722 Neurotrophin signaling pathway
    101353421
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101353421
   05205 Proteoglycans in cancer
    101353421
  09162 Cancer: specific types
   05210 Colorectal cancer
    101353421
   05212 Pancreatic cancer
    101353421
   05225 Hepatocellular carcinoma
    101353421
   05226 Gastric cancer
    101353421
   05214 Glioma
    101353421
   05216 Thyroid cancer
    101353421
   05221 Acute myeloid leukemia
    101353421
   05220 Chronic myeloid leukemia
    101353421
   05218 Melanoma
    101353421
   05211 Renal cell carcinoma
    101353421
   05219 Bladder cancer
    101353421
   05215 Prostate cancer
    101353421
   05213 Endometrial cancer
    101353421
   05224 Breast cancer
    101353421
   05223 Non-small cell lung cancer
    101353421
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101353421
   05022 Pathways of neurodegeneration - multiple diseases
    101353421
  09165 Substance dependence
   05034 Alcoholism
    101353421
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101353421
  09172 Infectious disease: viral
   05161 Hepatitis B
    101353421
   05160 Hepatitis C
    101353421
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101353421
   01522 Endocrine resistance
    101353421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101353421
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101353421
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101353421
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101353421
NCBI-ProteinID: XP_012412755
UniProt: A0A2Y9FYY4
LinkDB
Position
Unknown
AA seq 743 aa
MDPEAGPGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEE
YTSKLDSLQQREQQLLESLGDGAEFSVSSSASTDTVTSSSSSSLSVLPSSLSVFQNPTDV
SRTNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGE
KKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTC
GYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEETSFAETALAPGSSPPAPPSD
SPGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIR
NQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRR
DSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGV
LRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGM
DYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEV
IRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSN
CPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFS
LYACASPKTPIQAGGYGEFAAFK
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggatcccgaggccggccccggcgccgcggcctcgtcggccgcggaccctgctatcccc
gaggaggtgtggaatatcaaacagatgatcaagttgacacaggaacacatagaggcccta
ttggacaagtttggtggggagcacaatccaccgtcaatatacctggaggcctatgaagag
tacaccagcaagctggattccctccaacaaagagaacaacagttattggagtccctgggg
gatggagctgagttttctgtttctagctctgcatcaacggacaccgttacatcttcttcc
tcttctagcctttcagtgctgccttcatctctttcagtttttcaaaatcccacagatgtc
tcacggaccaaccccaagtcaccgcaaaaacctattgttagagtcttcctgcccaacaaa
cagagaacagtggtgcctgcaagatgtggtgtcaccgtccgggacagtctgaagaaagca
cttatgatgagaggtctgatcccagagtgctgtgctgtttacagaattcaggatggagag
aagaaaccaattggctgggacactgatatttcctggctcactggcgaggagttacatgta
gaagtgttggagaatgttccactcacaacacacaactttgtacggaaaacttttttcacc
ttggcattttgtgacttttgtcgaaagctccttttccaaggtttccgctgtcaaacatgt
ggttacaaatttcaccagcgctgtagtacagaggttccactgatgtgcgttaattatgac
caactggatttgctgtttgtctccaagttctttgaacaccacccaatcccgcaggaggag
acgtcctttgccgagactgcccttgctccgggatcgtcccctcccgcgcccccctcagac
tctcctgggcccccaattctcaccagtccgtctccttcaaaatccattccaattccacag
cccttccgaccagcagatgaagatcatcgaaatcaatttgggcagcgagaccggtcctca
tcagcccccaatgtgcatataaacacaatagagcctgtcaatattgatgacttgattaga
aaccaggggtttcgtggtgatggaggatcaaccacaggtttgtcggccacccctcccgca
tcgctccctggctccctcactaacgtgaaagccttacagaaatctcctggacctcagcgg
gaaaggaaatcctcgtcatcctcagaagacaggaatcgaatgaaaacacttggtcggcga
gattcaagtgacgactgggagattcccgatggacagatcacagttggacagagaatcgga
tccgggtcgtttggaaccgtctacaagggcaagtggcatggtgatgtggcagtgaaaatg
ttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtaggagta
ctcaggaaaacacgacacgtgaatatcctactctttatgggctattcaacaaagccacag
ctggctattgtcacccagtggtgtgagggctccagcttatatcaccatctccacatcatt
gagaccaaatttgagatgatcaaactcatagacattgcacggcagactgcacagggcatg
gattacttacacgccaagtccatcatccacagagacctcaagagtaataatatatttctt
catgaagacctcacagtaaaaataggtgattttggtctagcgacagtgaaatctcgatgg
agtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaagta
atcagaatgcaagataaaaacccctatagctttcagtcagatgtgtatgcatttgggatt
gttctgtatgaattaatgactggacagttaccttattcaaacatcaacaacagagaccag
ataatttttatggtgggacgaggatacctgtctccagatctcagtaaggtacggagtaac
tgtccaaaagccatgaagagattaatggcagagtgcctgaagaagaaacgagacgagaga
ccactctttccccaaattctcgcctccattgagctgctggcccgctcattgccaaaaatt
caccgcagtgcatccgaaccctccttgaatcgggccggcttccagacagaggattttagt
ctgtatgcttgtgcttctccaaaaacgcccatccaggcagggggctatggagaatttgca
gccttcaagtag

KEGG   Trichechus manatus latirostris (Florida manatee): 101357840
Entry
101357840         CDS       T05135                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu04270  Vascular smooth muscle contraction
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04510  Focal adhesion
tmu04540  Gap junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04613  Neutrophil extracellular trap formation
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04929  GnRH secretion
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05132  Salmonella infection
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101357840
   04012 ErbB signaling pathway
    101357840
   04014 Ras signaling pathway
    101357840
   04015 Rap1 signaling pathway
    101357840
   04370 VEGF signaling pathway
    101357840
   04371 Apelin signaling pathway
    101357840
   04630 JAK-STAT signaling pathway
    101357840
   04068 FoxO signaling pathway
    101357840
   04072 Phospholipase D signaling pathway
    101357840
   04071 Sphingolipid signaling pathway
    101357840
   04024 cAMP signaling pathway
    101357840
   04022 cGMP-PKG signaling pathway
    101357840
   04151 PI3K-Akt signaling pathway
    101357840
   04150 mTOR signaling pathway
    101357840
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101357840
  09143 Cell growth and death
   04210 Apoptosis
    101357840
   04218 Cellular senescence
    101357840
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101357840
   04540 Gap junction
    101357840
   04550 Signaling pathways regulating pluripotency of stem cells
    101357840
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101357840
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101357840
   04625 C-type lectin receptor signaling pathway
    101357840
   04650 Natural killer cell mediated cytotoxicity
    101357840
   04660 T cell receptor signaling pathway
    101357840
   04662 B cell receptor signaling pathway
    101357840
   04664 Fc epsilon RI signaling pathway
    101357840
   04666 Fc gamma R-mediated phagocytosis
    101357840
   04062 Chemokine signaling pathway
    101357840
  09152 Endocrine system
   04910 Insulin signaling pathway
    101357840
   04929 GnRH secretion
    101357840
   04912 GnRH signaling pathway
    101357840
   04915 Estrogen signaling pathway
    101357840
   04914 Progesterone-mediated oocyte maturation
    101357840
   04917 Prolactin signaling pathway
    101357840
   04921 Oxytocin signaling pathway
    101357840
   04926 Relaxin signaling pathway
    101357840
   04935 Growth hormone synthesis, secretion and action
    101357840
   04919 Thyroid hormone signaling pathway
    101357840
   04928 Parathyroid hormone synthesis, secretion and action
    101357840
   04916 Melanogenesis
    101357840
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101357840
  09156 Nervous system
   04726 Serotonergic synapse
    101357840
   04720 Long-term potentiation
    101357840
   04730 Long-term depression
    101357840
   04722 Neurotrophin signaling pathway
    101357840
  09158 Development and regeneration
   04360 Axon guidance
    101357840
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101357840
   05206 MicroRNAs in cancer
    101357840
   05205 Proteoglycans in cancer
    101357840
   05230 Central carbon metabolism in cancer
    101357840
   05231 Choline metabolism in cancer
    101357840
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101357840
  09162 Cancer: specific types
   05210 Colorectal cancer
    101357840
   05212 Pancreatic cancer
    101357840
   05225 Hepatocellular carcinoma
    101357840
   05226 Gastric cancer
    101357840
   05214 Glioma
    101357840
   05221 Acute myeloid leukemia
    101357840
   05220 Chronic myeloid leukemia
    101357840
   05218 Melanoma
    101357840
   05211 Renal cell carcinoma
    101357840
   05219 Bladder cancer
    101357840
   05215 Prostate cancer
    101357840
   05213 Endometrial cancer
    101357840
   05224 Breast cancer
    101357840
   05223 Non-small cell lung cancer
    101357840
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101357840
   05022 Pathways of neurodegeneration - multiple diseases
    101357840
  09165 Substance dependence
   05034 Alcoholism
    101357840
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101357840
   05152 Tuberculosis
    101357840
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101357840
   05161 Hepatitis B
    101357840
   05160 Hepatitis C
    101357840
   05164 Influenza A
    101357840
   05163 Human cytomegalovirus infection
    101357840
   05167 Kaposi sarcoma-associated herpesvirus infection
    101357840
   05165 Human papillomavirus infection
    101357840
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101357840
   01522 Endocrine resistance
    101357840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101357840
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101357840
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101357840
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 101357840
NCBI-ProteinID: XP_004368402
UniProt: A0A2Y9D5Z1
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRVIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPRTPVPAQRERAPGSGTQEKNKIRSRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgcg
gtgtttgatggctccagctgcatctcccctacaatagttcagcagtttggctatcagcgc
cgggcgtcagatgatggcaaactcacagattcttctaagacaagcaatactatccgagtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcacgac
tgccttatgaaagccctcaaagtgaggggcttgcaaccagagtgctgtgcagtgttccga
cttctccatgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctct
ttgattggagaagagcttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaagtttctgcta
aatgggtttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctgttgttatttccaaattccact
gtcggtgatagtggggtcccggcactaccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgccttcacgttc
aacacttccagcccctcctcagagggttcactgtcccagaggcagaggtcgacatccacg
cctaatgtccacatggtcagcaccaccctgcctgtggacagcagggtgatagaggatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagcagtcccaacaatttg
agcccaacgggctggtcacagcccagaacccctgtgccggcacagagagagcgggcgcca
ggatctgggacccaggagaaaaacaaaattaggtctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccacccggattgggtcaggatcgttt
ggcactgtttataagggcaagtggcatggagatgttgcagtaaagatcctcaaggttgtt
gacccaacacctgagcagttccaggcctttaggaatgaggtggctgtcctgcggaaaaca
cggcacgtgaacatcttgcttttcatggggtacatgacgaaggacaacctggcgattgtg
acccagtggtgtgaaggcagcagcctctataaacacctgcatgtccaggagaccaagttt
cagatgttccagttgattgatattgcccggcagacagctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccacgaaggcctg
acagtgaaaattggagattttggtttggcaacggtaaagtcacgctggagtggttctcag
caggttgaacaacccaccggctctatcctgtggatggccccagaggtgatccggatgcag
gacaataacccattcagcttccagtctgatgtctattcctatggcattgtattgtatgag
ctgatgacgggggaacttccttactcacacatcaacaaccgggatcagatcatcttcatg
gtgggtcgagggtatgcctccccagatcttagtaagctatacaagaactgccccaaagca
atgaagaggcttgtagccgactgtgtgaagaaagttaaggaagaaaggcctcttttcccc
cagatcctgtcttccattgagctgctccagcactctctaccgaaaatcaaccggagtgct
tctgagccatccctgcaccgggcggcccacactgaggatatcaatgcctgcacgttgacc
acgtcccctagactgcctgtcttctag

DBGET integrated database retrieval system