KEGG   Trichechus manatus latirostris (Florida manatee): 101351852
Entry
101351852         CDS       T05135                                 

Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04010  MAPK signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04137  Mitophagy - animal
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04216  Ferroptosis
tmu04218  Cellular senescence
tmu04310  Wnt signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu05012  Parkinson disease
tmu05014  Amyotrophic lateral sclerosis
tmu05016  Huntington disease
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101351852
   04310 Wnt signaling pathway
    101351852
   04071 Sphingolipid signaling pathway
    101351852
   04151 PI3K-Akt signaling pathway
    101351852
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101351852
  09143 Cell growth and death
   04110 Cell cycle
    101351852
   04210 Apoptosis
    101351852
   04216 Ferroptosis
    101351852
   04115 p53 signaling pathway
    101351852
   04218 Cellular senescence
    101351852
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101351852
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101351852
  09149 Aging
   04211 Longevity regulating pathway
    101351852
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101351852
   05202 Transcriptional misregulation in cancer
    101351852
   05206 MicroRNAs in cancer
    101351852
   05205 Proteoglycans in cancer
    101351852
   05203 Viral carcinogenesis
    101351852
   05230 Central carbon metabolism in cancer
    101351852
  09162 Cancer: specific types
   05210 Colorectal cancer
    101351852
   05212 Pancreatic cancer
    101351852
   05225 Hepatocellular carcinoma
    101351852
   05226 Gastric cancer
    101351852
   05214 Glioma
    101351852
   05216 Thyroid cancer
    101351852
   05220 Chronic myeloid leukemia
    101351852
   05217 Basal cell carcinoma
    101351852
   05218 Melanoma
    101351852
   05219 Bladder cancer
    101351852
   05215 Prostate cancer
    101351852
   05213 Endometrial cancer
    101351852
   05224 Breast cancer
    101351852
   05222 Small cell lung cancer
    101351852
   05223 Non-small cell lung cancer
    101351852
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101351852
   05014 Amyotrophic lateral sclerosis
    101351852
   05016 Huntington disease
    101351852
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101351852
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101351852
   05161 Hepatitis B
    101351852
   05160 Hepatitis C
    101351852
   05162 Measles
    101351852
   05168 Herpes simplex virus 1 infection
    101351852
   05163 Human cytomegalovirus infection
    101351852
   05167 Kaposi sarcoma-associated herpesvirus infection
    101351852
   05169 Epstein-Barr virus infection
    101351852
   05165 Human papillomavirus infection
    101351852
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101351852
   01522 Endocrine resistance
    101351852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101351852
   03036 Chromosome and associated proteins [BR:tmu03036]
    101351852
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101351852
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    101351852
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101351852
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101351852
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 101351852
NCBI-ProteinID: XP_004376078
UniProt: A0A2Y9R5B9
LinkDB
Position
Unknown
AA seq 392 aa
MEEPQSDLSTELPLSQETFSYLWELLPEKPVLSPSLPPAVEVVEVADDLLLTEDAATWLE
SQVGAQEISAGPAPATPTPVALIPATSWTLSSSVPSQKTYPGTYGFRLGFLHSGTAKSVT
CTYSPDLNKLFCQLAKTCPVQLWVTSPPPPGTRVRTMAIYKKSEHMTEVVKRCPHHERCS
DYSDGLAPPQHLIRVEGNLRAEYLEDSVTLRHSVVVPYEPPEVGSDCTTIHFNFMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRNSFEVRICACPGRDRRTEEENFHKKGETSPEPPPG
RSTKRALPTNTSSCTQPKKKPLDEEYFTLQIRGRERFKMFLELNEALELKDAQAGKEPEG
SRAHSSPPKSKKGQSTSRHKKLMFKREGPDSD
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggaggagccccagtcagatctcagcactgagctccctctgagtcaagagacattttca
tacttatgggaactccttcctgagaagccggttctgtccccctcgctacccccagcagtg
gaggtagtagaggtagcagatgatctgctactcacggaagatgctgcaacctggctagaa
agccaggtaggggctcaagaaatatcagcaggccccgcaccagccacccctacaccagtg
gctctcataccagccacctcctggaccctgtcatcctccgtcccttctcagaagacctac
cctggcacctatggtttccgcctgggcttcctgcattctgggacagccaagtccgtcacc
tgcacgtattccccagaccttaacaagctgttttgccagctggcaaagacctgcccagtg
cagctgtgggtcacctcaccacccccacctggcacccgtgttcgcaccatggcgatctac
aagaagtcagagcatatgacagaggtcgtgaagcgctgcccccaccatgagcgctgctct
gactatagcgatggcctggcccctcctcagcacctcatccgggtggaaggaaacctgcgt
gctgagtatctggaggacagcgtcactcttcgacatagtgtggtggtgccctatgagccg
cccgaggtcggctctgactgtaccactatccacttcaacttcatgtgtaacagctcctgc
atgggaggcatgaaccggcggcccatcctcaccatcatcacactggaagactccagtggt
aatctgctgggacgtaacagctttgaggtgcgcatctgtgcctgtcctgggagagacaga
cgtacagaggaagaaaatttccacaagaagggggagacttcccctgagccaccccctggg
aggagcactaagcgagcactgcccaccaacaccagctcctgtacccagccaaagaagaaa
ccactggatgaagaatatttcacccttcagatccgtgggcgtgaacgcttcaagatgttc
ctagagctgaatgaggccttggagctgaaggatgcccaggctgggaaggagccagaaggg
agcagggctcactccagccctccgaagtctaagaagggacaatctacctcccgccataaa
aaactaatgttcaagagagaggggcctgactcagactga

DBGET integrated database retrieval system