KEGG   Trichechus manatus latirostris (Florida manatee): 101352047
Entry
101352047         CDS       T05135                                 

Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04140  Autophagy - animal
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04370  VEGF signaling pathway
tmu04510  Focal adhesion
tmu04722  Neurotrophin signaling pathway
tmu04910  Insulin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu05010  Alzheimer disease
tmu05014  Amyotrophic lateral sclerosis
tmu05020  Prion disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05145  Toxoplasmosis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05165  Human papillomavirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101352047
   04014 Ras signaling pathway
    101352047
   04370 VEGF signaling pathway
    101352047
   04024 cAMP signaling pathway
    101352047
   04022 cGMP-PKG signaling pathway
    101352047
   04151 PI3K-Akt signaling pathway
    101352047
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101352047
  09143 Cell growth and death
   04210 Apoptosis
    101352047
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101352047
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101352047
  09152 Endocrine system
   04910 Insulin signaling pathway
    101352047
   04919 Thyroid hormone signaling pathway
    101352047
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101352047
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101352047
   05203 Viral carcinogenesis
    101352047
  09162 Cancer: specific types
   05210 Colorectal cancer
    101352047
   05212 Pancreatic cancer
    101352047
   05225 Hepatocellular carcinoma
    101352047
   05221 Acute myeloid leukemia
    101352047
   05220 Chronic myeloid leukemia
    101352047
   05218 Melanoma
    101352047
   05211 Renal cell carcinoma
    101352047
   05215 Prostate cancer
    101352047
   05213 Endometrial cancer
    101352047
   05223 Non-small cell lung cancer
    101352047
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101352047
   05014 Amyotrophic lateral sclerosis
    101352047
   05020 Prion disease
    101352047
   05022 Pathways of neurodegeneration - multiple diseases
    101352047
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101352047
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101352047
   05161 Hepatitis B
    101352047
   05160 Hepatitis C
    101352047
   05162 Measles
    101352047
   05168 Herpes simplex virus 1 infection
    101352047
   05165 Human papillomavirus infection
    101352047
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101352047
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101352047
   01524 Platinum drug resistance
    101352047
   01522 Endocrine resistance
    101352047
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 101352047
NCBI-ProteinID: XP_023594003
UniProt: A0A2Y9RPZ9
LinkDB
Position
Unknown
AA seq 167 aa
MFQIPEFEQSDREDSSPAHRCLGPSPKRGRPSGPRNRHHASPGPLGDASHQQGQPTSSSH
HGGADTVETRSRHSSYPVGSEEGEGLEDEPSPFRGRSLSAPPNLWAAQRYGRELRRMSDE
FEGSFKGLPRPKSAGTATQMRQSPSWTRIIQSWWDRNLGRGGSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgaccgggaagactccagtcctgcacatagg
tgcctgggccccagccccaaaaggggccggccctcaggccccagaaaccgccaccacgcg
tccccaggccccctgggggatgccagtcaccagcagggacagccgaccagcagcagccac
catggaggcgctgacactgtggagacccggagtcgccacagctcataccccgtgggttcc
gaggagggtgaggggctggaggacgagcccagcccctttcggggccgctcactctcggcg
ccgcccaacctctgggctgcacagcgatatggccgtgagctccgcaggatgagtgatgag
ttcgagggctctttcaagggacttcctcgcccgaagagcgcgggcacagcaacgcagatg
cggcaaagccccagctggacacgcatcatccagtcctggtgggatcggaatttggggaga
ggtggctccgccccctctcaatga

DBGET integrated database retrieval system