KEGG   Trichechus manatus latirostris (Florida manatee): 101352048
Entry
101352048         CDS       T05135                                 

Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3 isoform X2
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04640  Hematopoietic cell lineage
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
tmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101352048
   04014 Ras signaling pathway
    101352048
   04151 PI3K-Akt signaling pathway
    101352048
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101352048
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101352048
   05202 Transcriptional misregulation in cancer
    101352048
   05230 Central carbon metabolism in cancer
    101352048
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101352048
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101352048
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tmu04090]
    101352048
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101352048
Protein kinases [BR:tmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101352048
CD molecules [BR:tmu04090]
 Proteins
  101352048
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 Ig_2 ig I-set APH
Other DBs
NCBI-GeneID: 101352048
NCBI-ProteinID: XP_004384199
UniProt: A0A2Y9E134
LinkDB
Position
Unknown
AA seq 974 aa
MICGTFTNQDLPVIKCVLINHKNNDSSVGLSSSYPMVSRSMEDLGCSLRPESTELIYEAD
KVEVDVSASITLQVMVSIPGNISCLWIFKHSSLNCQPYFDLQNRGVVSMVILKMTETQAG
EYLLFIQSEATNYTILFTVSIRNTPLYTLRRPYFRKMENQDALLCISESIPEPVVEWVFC
DSQSESCKEEGPAVVKKEEKVLHELFGTDIRCCAKNKLGRECTKLFTIDLNATPQTTLPQ
LFLKVGEPLWIRCKAVYINHRFELKWELGNKMLTEDSYFEMSTYSTNRTMIRILFAFVSS
VGRNDTGSYTCSSSEHPSKSTLVTVVDKGFINGSNSSEDYEIDQYEEFCFSVRFKAYPQI
KCTWTFSRKSFPCEQSGLEDGYSVSKFCNHRHQPGEYIFHAENDDAQFTKMFTLNIRRRP
QVLTETSTSQASCSSDGYPLPSWTWKKCSEKSPNCTEEITEGIWTKKARRQVFGQWISSS
TLNISEAVKGFRVKCCAYNSIGSSCETILLNSPGPFPFIQENISFYATIGLCLPFIAVLT
MLLYHKYKKQFRYESQLQMVQVTGSLDNEYFYIDFRESEYDLKWEFPRENLEFGKVLGSG
AFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEKEALMSELKMMTHLGSHENIVNLLG
ACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNPSVPG
SREVQIQKDLDQISGFNGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVSKGM
EFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPES
LFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIESGFKMDQPFYATEEIY
FIMQSCWAFDSRKRPSFLNLTSFLGCQLADAEEAMYQNMDGRILERPSIYQNRRPCSQEM
NSGAPSPQAQAEDS
NT seq 2925 nt   +upstreamnt  +downstreamnt
atgatatgcgggacttttacaaaccaagatctgcctgtgatcaagtgtgttttaatcaat
cataagaacaatgattcatcagtggggctatcatcatcatatcccatggtatcgagatca
atggaagaccttgggtgctcgctgaggcccgagagcacagagctcatctatgaagcagac
aaggtagaagttgatgtctctgcatccattaccctacaggtgatggtcagcatccctggg
aacatttcgtgtctctggatctttaaacacagttccctgaactgccaaccatactttgat
ttacagaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaggctgga
gaatacctgctttttattcagagtgaagcgaccaattacacaatattgtttacagtgagt
ataagaaatacaccactttacacattaagaagaccttacttcagaaaaatggaaaatcaa
gatgcactgctctgcatatctgagagcattccagaaccggtggtggaatgggtgttttgc
gattcacagagtgaaagctgtaaagaagaaggtccggctgttgttaaaaaggaggaaaag
gttcttcatgaattatttggaacagacataagatgctgtgcaaaaaataaattgggcagg
gagtgtaccaagctgttcacaatagatctaaatgccactccgcagacaaccttgccccaa
ttatttctcaaagtaggggaaccactgtggataagatgcaaagctgtttacataaaccat
agattcgagctcaaatgggaattaggaaacaaaatgctcacagaggacagctactttgag
atgagtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatca
gtgggaagaaacgacactggatcctacacttgttcgtcttcagagcatcccagtaaatca
actttggttaccgtcgtagacaagggatttataaatggttccaattcaagtgaagattat
gaaattgaccagtatgaagagttttgtttttctgttcggtttaaagcatacccacaaatc
aaatgtacgtggaccttttctcggaaatcttttccctgtgaacaaagtggccttgaggat
ggatacagcgtatctaagttttgcaaccatagacaccagccaggagaatatatattccat
gcagaaaatgatgatgcccagttcacaaaaatgtttacgctgaatataagaaggaggcct
caagtactgactgagacatcaacgagtcaggcctcttgttcctctgatggatacccatta
ccatcttggacctggaagaagtgctcagagaagtctcccaactgcacagaagaaatcaca
gaaggaatttggactaaaaaggctcgcagacaagtgtttggacaatggatatcaagtagt
accctcaacatcagtgaagcagtcaaaggtttccgggtcaagtgctgtgcatacaattcc
ataggctcgtcttgtgaaacaatccttttaaactcaccaggccccttccctttcattcaa
gagaacatctcattctacgcaacaattggactttgtcttcccttcattgcggttttaact
atgctactttatcacaagtacaaaaagcaatttaggtatgaaagccagctgcaaatggta
caggtgactggctcattggataatgagtacttctacattgatttcagagaatctgagtat
gatctcaaatgggagtttccaagagaaaatttagaatttgggaaggtgctaggatcgggt
gcttttggaaaagtgatgaatgcaacagcttatggaattagtaaaacaggagtctcaatc
caggttgcagtcaaaatgctgaaagaaaaggcagacagttctgaaaaagaggctctcatg
tcagaactcaaaatgatgactcaccttggaagccatgagaatattgtgaatctgttggga
gcatgtacactgtcaggaccaatctacttgatctttgaatactgttgctatggtgatctt
ctcaactacctaagaagtaaaagagaaaaatttcacaggacatggacggagatttttaag
gaacacaatttcagtttttaccccactttccagtcacatccaaatcccagcgtgcctggt
tcaagagaagtacaaatacagaaggatttggatcagatctcagggttcaatgggaattca
tttcattccgaagatgaaattgaatatgaaaaccaaaaaaggctggaagaagaagaggac
ttgaatgtacttacatttgaggatctcctttgctttgcatatcaagtttccaaaggcatg
gaatttctggagtttaagtcgtgtgttcacagagacctggcagccaggaatgtgctggtg
acccatggaaaagtggtgaagatatgtgattttggactggctcgggacataatgagtgac
tccaactatgttgtcaggggcaatgcccgtttgcctgtgaaatggatggcccctgaaagc
ttgtttgaagggatctacacgattaagagcgatgtctggtcatatggaatattactctgg
gaaatattctcacttggcgtgaacccttatcctggcattccagttgatgcaaacttctat
aaactcattgagagtggatttaaaatggatcagccattttatgcaacagaagaaatatat
tttattatgcaatcctgctgggcttttgactcgaggaagcggccgtctttccttaacctg
acttcatttctaggatgtcagctagcagacgcagaagaagcgatgtatcagaacatggat
ggccgtatcttggaacgtccttccatctaccaaaacaggcgaccttgcagccaagaaatg
aattcaggggcaccctctccacaggctcaggctgaagattcatag

DBGET integrated database retrieval system