KEGG   Trichechus manatus latirostris (Florida manatee): 101352081Help
Entry
101352081         CDS       T05135                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00010  Glycolysis / Gluconeogenesis
tmu00030  Pentose phosphate pathway
tmu00051  Fructose and mannose metabolism
tmu00052  Galactose metabolism
tmu01100  Metabolic pathways
tmu01200  Carbon metabolism
tmu01230  Biosynthesis of amino acids
tmu03018  RNA degradation
tmu04152  AMPK signaling pathway
tmu05230  Central carbon metabolism in cancer
Module
tmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101352081
   00030 Pentose phosphate pathway
    101352081
   00051 Fructose and mannose metabolism
    101352081
   00052 Galactose metabolism
    101352081
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101352081
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101352081
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101352081
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tmu01009]
    101352081
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tmu03019]
    101352081
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101352081
Protein phosphatases and associated proteins [BR:tmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101352081
Messenger RNA biogenesis [BR:tmu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101352081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101352081
NCBI-ProteinID: XP_004390083
UniProt: A0A2Y9EAG9
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MDAPSTPRGFLRKYLEHLSGAGIAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYE
GYQGMVDGGSNIVEASWESVSSILQIGGTIIGSARCQAFRTREGRLKAAHNLIQLGITNL
CVIGGDGSLTGANIFREEWSGLLEELAQSGKIDSDAVKKYAYLNIVGMVGSIDNDFCGTD
MTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPES
PPEERWEENMCVKLSENRARKKRLNIIIVAEGAIDSQNKPITSEKIKDLVVKQLGYDTRV
TILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPEIPACVVSLSGNHAVRLPLMECVQ
MTQDVQKAMDERKFKKAVQLRGRNFESNLNTYKRLCIKLPDSQIVKSNCNVAIINVGAPA
AGMNAAVRSAVRTGISDGHRMLAVYDGFDGFSKGQIKEISWTDVGGWTGQGGSILGTKRI
LPGKYLEEIAEQMRAHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMIMVPATVSNN
VPGSDFSIGADTALNTITDTCDRLKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADA
AYIFEEPFDIRDLQSNVEHLTQKMKTSIQRGLVLRNENCSENYTTDFICQLYSEEGKGVF
DCRKNVLGHMQQGGAPSPFDRNFGTKMSAKAMQWITVKLKDSQRTGRKFVTDDSVCVLGI
SKRNLVFQSVADLKKDTDFVHRIPKEQWWLKLRPVMKILAKYKASYDVSDSGQLEHVHLH
PQEESAGI
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggacgccccctctacacccaggggcttcctcaggaagtacctggaacacctctccggg
gccggaatagccattggagtcctgaccagcggcggggatgcccaaggtatgaatgctgct
gttcgtgctgtagtgcgcatgggaatctacgtaggagccaaagtgtattttatatatgag
ggttaccaaggtatggtagatggaggttctaatattgttgaagcctcatgggaaagcgtc
tccagcattctacaaataggagggacaatcatcggcagtgcacgttgccaagcatttcgt
actcgggaaggtcgcttaaaagctgcccataacttgattcagctgggaattacgaatctg
tgtgtgattggtggggatggaagcttaacaggggccaatatcttccgggaggaatggagt
ggactgctggaagagttggcccaaagtggcaagattgattcagatgctgtgaagaagtat
gcgtacctcaacattgtgggcatggtgggctccatcgacaacgacttctgtgggacagac
atgaccatcggcacggactcagctctgcacaggattattgaagttgttgatgccatcatg
accacggcgcagagccaccagaggacctttgttctggaggttatggggagacactgtgga
tatctagccctggttagtgccttggcctgtggtgcagactgggtatttcttcctgaatcc
cccccagaagaacgctgggaggaaaatatgtgcgttaaactctcagagaaccgtgctcga
aagaaaaggctgaacattatcattgtggctgaaggagctattgattcccaaaataaacct
attacatctgagaaaatcaaggatttagtagttaagcagctggggtacgacactcgagtg
acaatacttggacatgtgcaaagaggaggaactccatcagcttttgacaggattttggcc
agtcgcatgggggtggaggctgtcatcgcccttcttgaagcgaccccagagatcccggcc
tgtgtggtgtccctgagtggaaaccacgcggtgcgcctgccgctgatggagtgtgtgcag
atgacccaggatgtgcaaaaggcaatggatgaaaggaaatttaaaaaggccgtacaactt
agaggaaggaactttgagagcaacctgaacacctataagcggctttgcatcaagcttcca
gactcacagattgtgaagagcaattgtaacgtggctattataaacgtgggtgccccagca
gctgggatgaatgctgctgtacgctcggctgtacgaacggggatatctgatggccacaga
atgctcgctgtctacgatggctttgatggattttccaaaggtcagataaaagaaatcagc
tggacagatgttggaggttggaccggccaaggaggatcgattcttggaacaaaacgtatt
ctacctggaaagtatttggaggagattgctgaacagatgcgtgctcacagtatcaacgct
ctattgattattggtggatttgaggcctacctgggactgctagagctgtcagctgcccgg
gagaaacacgaggagttctgtgttcctatgattatggttcctgctactgtctccaacaat
gtccctggttcagatttcagcattggtgcagacactgctctgaacactatcactgacaca
tgtgaccgcctcaagcagtcagccagtgggaccaagcgccgcgtgttcatcattgaaact
atgggcggctactgcggttacctggccaacatggggggacttgcggccggagctgatgca
gcttatatttttgaagaaccatttgatatcagagatttacagtccaacgtggagcacctg
acacagaaaatgaagaccagcattcagaggggtcttgtgctcagaaacgagaactgcagt
gaaaattataccaccgacttcatttgccagctttattcagaagaaggaaaaggagtattt
gattgcagaaagaatgtgctgggccacatgcagcagggtggagcaccttccccatttgat
aggaactttggaacaaagatgtctgccaaagctatgcagtggattactgtgaaactgaag
gactctcaacgaacaggaagaaagtttgtaactgatgactcagtctgtgtgctgggaata
agcaaaagaaaccttgtttttcaatcagtggcagacctaaagaaggacacggatttcgtg
cacagaattcccaaagaacagtggtggttgaaactgaggcctgtaatgaaaattttggct
aagtacaaagcaagctacgatgtttctgattctggccagctcgagcatgtgcatctccat
cctcaagaggaatctgcagggatttaa

DBGET integrated database retrieval system