KEGG   Trichechus manatus latirostris (Florida manatee): 101352454Help
Entry
101352454         CDS       T05135                                 

Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101352454
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101352454
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101352454
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101352454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101352454
NCBI-ProteinID: XP_004377728
UniProt: A0A2Y9R8V8
LinkDB All DBs
Position
Unknown
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISQEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHVYNWERYHDC
QFSDHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
PEPCWQYPDHHENKYCDLECSHTCNYKTSSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKRGKSKCERNGLVKAQIALEEASQQLAEKEREKNQGFDFDSFIAGTIQLSSQ
HDPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFLINQFCCEVRKDEQDGKENTYTSYLDKFFSRKEDAEMLETEPVEDGKLGERGNEE
GFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSTMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagacgactagaccatgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccagttaacagacgatgtgggctctcttactgaa
ctgaacagtgtttacattgttcaggaatacatggagacagacttggctaatgtgctggag
cagggccccttactggaggagcatgcgaggcttttcatgtatcagctgctacgtgggctc
aagtatattcactctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttcacctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcaactgattttagaatctatacctgtcgtacatgaggaagatcgtcaggagcttctc
agtgtaattccagtttacattagaaacgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcaagaagcactggatttcctggaacaaattttgacatttagt
cccatggatcggctgacagcagaagaagcactctcccatccttacatgagcatatattct
tttccaacggatgaaccaatttcaagtcatccctttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcatagtcacgtttataactgggaaaggtaccatgattgt
cagttttcagaccacgattggcctatacataacaactttgatattgatgaagttcagctt
gatccaagggctctgtctgatgtcactgatgaagaagaagtacaggtcgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaagatcctgcttttgataccaattactct
cctgagccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacttgtaactacaaaacaagctcatcgtcatatttagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagagaggcaagtcaaaatgtgaaaggaatggattg
gttaaagcccagatagctctagaagaagcatcacagcaactggctgaaaaagaaagggag
aagaatcagggattcgattttgattcctttattgcaggcactattcaactcagttcacaa
catgatcctactgatgtggttgataaattaaatgacttgaatagctcggtgtcccaacta
gaattgaaaagtttgatatccaagtcagtaagccaagaaaaacaggaaaaaggaatggca
aatttggcgcagttagaagccttgtaccagtcttcttgggatagccagtttgtgagtgga
ggggaggactgttttctcataaatcagttttgttgtgaggtaaggaaggatgaacaagat
gggaaggaaaacacttacaccagttacttggacaagttctttagcaggaaagaagatgct
gaaatgctagaaactgagccagtagaggatgggaagcttggggagagagggaatgaggaa
ggatttctgaacaacagtggtgagttcctctttaacaagcagcttgaatccataggcatc
ccacagtttcacagtccagttgggtcaccacttaagtcaatacaggccacattaacacct
tctactatgaaatcttcccctcagattcctcataaaacatacagcagcattctaaaacat
ctgaactaa

DBGET integrated database retrieval system