KEGG   Trichechus manatus latirostris (Florida manatee): 101352574
Entry
101352574         CDS       T05135                                 

Definition
(RefSeq) transcription factor PU.1 isoform X2
  KO
K09438  transcription factor PU.1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04380  Osteoclast differentiation
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101352574
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101352574
   05202 Transcriptional misregulation in cancer
    101352574
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101352574
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101352574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101352574
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101352574
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 101352574
NCBI-ProteinID: XP_004387757
UniProt: A0A2Y9E7K1
LinkDB
Position
Unknown
AA seq 270 aa
MLQACKMEGFPLVPPPTEDLVPYDADLYQRPTHDYYQYLSSDGDSHSDHYWDFHPHHVHS
EFESFTENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMAPPHASLGHQVSYLPRMCVP
YPSLSPAQPSSDEEEGERHSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 813 nt   +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctccaacggaagacctg
gttccctatgacgcggatctgtaccaacgcccaacgcacgattactaccaatatctcagc
agcgatggagacagccacagtgaccattactgggacttccacccccaccacgtgcacagc
gagttcgagagcttcacggagaaccacttcaccgagctgcagagcgtgcagcccccgcag
ctgcagcaactctaccgacacatggagctggagcagatgcacgtcctcgacacccccatg
gcgccgccccacgccagcctcggccaccaggtctcctacctgccccggatgtgcgtccca
tacccctccctgtccccggcccagcccagctcggatgaggaggagggtgagcggcacagc
cccccactggaggtgtctgacggggaggccgatggcctggagccggggcccggcctcctg
catggggaaacagggagcaagaagaagatccgcctgtaccagttcctgctcgacctgctc
cgcagtggcgacatgaaagacagcatctggtgggtggacaaggacaagggaaccttccag
ttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaaccgc
aagaagatgacctatcagaaaatggcccgcgcgctgcgcaactatggcaagacaggcgag
gtcaagaaggtcaagaagaagctcacctaccagttcagcggggaggtgctgggccgcggg
ggcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system