KEGG   Trichechus manatus latirostris (Florida manatee): 101352819Help
Entry
101352819         CDS       T05135                                 

Definition
(RefSeq) DNA-directed DNA/RNA polymerase mu isoform X1
  KO
K03513  DNA polymerase mu [EC:2.7.7.7]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    101352819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tmu03400]
    101352819
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101352819
DNA repair and recombination proteins [BR:tmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     101352819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_thumb DNA_pol_lambd_f HHH_8 DNA_pol_B_palm NTP_transf_2 Cdd1 BRCT HHH_5
Motif
Other DBs
NCBI-GeneID: 101352819
NCBI-ProteinID: XP_004386168
UniProt: A0A2Y9E2W6
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MGRGVAPCYLCGGGCHFLFERTSLCLPSVFLPVSVPCRLSSAAMVPVLPKRRRAQVGSPA
GATASSAEPSARFPGVAIYLAEPRMGRSRRAFLTRLALSKGFRVLDEYSSEVTHVVMEQT
SAVEAVCWQERKAVAALSDWTLSKLVNMSWFTESMAAGQPVPVECWHLLEVTKPSKGVPS
PAWVPAYACQRLTPLTHHNTSLSEALETLAEAAGFEGSEGRLLSFRKAASVLKALPSPII
ALRQLQGLPHFGEHSSRVIQEMLENGVCEEVERVQHSERYQTMKLFTQIFGVGVKTADRW
YQEGLRTLDDLLKQPQKLTQQQKAGLQHHQDLSTPVQQQDAEALRQMVEAAVVQALPGAT
VMLTGGFRRGKLQGHDVDLLITHPQEGQEVGLLPRVVGCLKNQGLILYHLYQHNHYGDPA
YPARQNSTMDTFEKSFCIFCLPQPPGAAVEGPQRPCRAWKAVRVDLVVTPVSQFPFALLG
WTGSKHFERELRWFSRKEKGLWLNSHGLFDPEQKKFFHVTSEEDIFRHLGLEYIPPEQRN
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtggtgtggccccctgttatttgtgtggaggcgggtgtcacttccttttcgag
cggacttccctctgccttccgtctgttttccttccggtctccgtaccctgccgcctttca
tccgccgctatggttccggtgcttccgaagcggcggcgagcgcaggtcgggtccccggcc
ggcgccactgcctcctccgcggagccttcggctcgcttccccggcgtcgccatctacctg
gcggagccgcgcatgggccgcagccgccgcgccttcctcacccggctggcactctccaaa
ggcttccgcgtcctggacgagtacagctccgaggtgacacacgtggtaatggagcagacc
tcggcagtggaggctgtctgctggcaggagcgcaaggcagtggctgctctctcagattgg
accctctcaaaactggtgaacatgagctggttcacagagagcatggcggctgggcagcct
gtgcctgtggagtgctggcacctcctggaggtgaccaagcccagcaagggggttcccagc
ccagcatgggtgccagcctatgcctgccagcgtctcacgcctctcacacaccataacacc
agcctgtcggaggctctggagacactggcagaggcagcaggcttcgaaggcagcgagggc
cgcctcctctcattccgcaaggcagcctctgtgctcaaggccctgcccagccccatcata
gccctgaggcaattgcaagggctcccccactttggagaacactcctccagggtcatccag
gagatgctggagaatggagtatgtgaagaggtggagagggtgcagcactcagagaggtac
cagaccatgaagctcttcacccagatctttggggtcggggtaaagactgctgaccgctgg
taccaggaagggctacggaccctggatgacctcctcaagcagccccagaaactgacccag
cagcagaaagcaggcctccagcaccaccaagacctgagcaccccagtgcagcagcaggac
gcggaggctctgcggcagatggtggaggcggctgtggtgcaggccctgcccggtgccact
gtcatgctgactggtggcttccggagggggaagttgcagggccacgacgtggacttgctc
atcactcaccctcaggaaggccaggaagtggggctgctgcccagagtggtgggctgcctg
aagaaccagggcctcatcctgtaccacctctaccagcataaccactatggggaccctgcc
tacccagcgcggcagaactccaccatggatacctttgagaagagtttctgcattttttgc
ctgccgcaaccccctggggcagctgttgaggggccccagaggccctgccgggcctggaag
gcggtgagggtagacctggtggtcaccccggtcagccagtttccctttgccctgcttggc
tggacgggctccaagcatttcgaacgggagctgcgctggttcagccggaaggagaagggg
ctgtggctgaatagtcacgggctctttgacccagagcagaagaagtttttccatgtgact
tcagaggaggacatcttcagacatctgggcctggagtacattcctcctgagcagaggaac
gcctga

DBGET integrated database retrieval system