KEGG   Trichechus manatus latirostris (Florida manatee): 101353481Help
Entry
101353481         CDS       T05135                                 

Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tmu01002]
    101353481
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tmu03110]
    101353481
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     101353481
Peptidases [BR:tmu01002]
 Serine Peptidases
  Family S8: subtilisin family
   101353481
Chaperones and folding catalysts [BR:tmu03110]
 Intramolecular chaperones
  Subtilisin family
   101353481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 101353481
NCBI-ProteinID: XP_004375097
LinkDB All DBs
Position
Unknown
AA seq 753 aa AA seqDB search
MELRAWTLQGTALALFCALCALNCVGAKRQFVNEWAAEISGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSALHITKRLSDDVRVIWAEQQYEKDRSKRTALKDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGIAYDSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHDDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLRVTDMSGRTQNEGRIVNWKLILHGTAPQPEH
MKQPRVYTSYNTVQNDRRGVEKMVHSGEEQPTPENLNENPLVAKSPSSSSVGNRRDEMAG
GAPSEAMLRLLQSAFSKNSPSKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLRDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagagcctggaccctgcagggtactgctttagccctcttttgcgctttgtgc
gcattgaactgtgtgggagcaaagaggcagtttgtcaatgaatgggcggcggaaatctcc
gggggaccggaggcagcctcggccatagctgaggagctgggctatgaccttttgggtcag
attggatctcttgaaaatcactacttattcaaacataaaaaccatcctcgaaggtctcga
aggagtgcccttcacatcactaaaagattatctgatgatgttcgagtgatatgggctgag
caacagtatgaaaaagatagaagtaaacgtacagctctaaaagattcagcattaaatctc
ttcaatgatccgatgtggaaccagcagtggtacttgcaagataccaggatgacggcagct
ttgcccaagctggacctccatgtgatacctgtgtggcaaaaaggcatcacgggcaaagga
gttgttatcactgtactggatgatggcttggagtggaatcacacagacatctatgccaat
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacacgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaagtgtggggtcggaattgcatacgattccaaagttggaggcataagaatg
ctagatggcattgtgaccgatgctattgaggccagttcaataggattcaaccccggacat
gtggatatttacagtgcaagctggggcccaaatgatgatggaaaaactgtggaggggcct
ggccgactagcccagaaggcttttgaatatggtgtcaaacaggggagacaaggcaagggc
tccatcttcgtctgggcttcggggaacggggggcgtcagggagacaactgtgactgtgat
gggtacacggacagcatctacaccatctccatcagcagtgcttcccagcaaggcctctcg
ccctggtatgccgagaagtgttcctcgacgctggccacctcttacagcagcggggattac
accgaccagcgaattacaagtgctgacctgcacgatgactgcacagagacccacacaggc
acctcggcctcggcacccctggctgctggcatcttcgctttggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacttggttgtctggacctctgagtatgacccactg
gccaataaccctggatggaaaaagaatggtgcaggcttgatggtgaatagtcgatttgga
tttgggttgctaaatgccaaagcactggtagatttagctgatcccaggacctggagcagc
gtgcctgagaagaaagagtgcgttgtaaaggacaatgactttgagcccagagccctgaaa
gctaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaacgct
atcaaatccctggagcatgtgcaatttgaagcaacgatcgaatattctcgcagaggggac
cttcacgtcacactcacttctgctgctggaaccagcactgtactgttggctgaaagagag
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcacacatgggga
gagaatcctgtaggcacctggactttgcgagttacagacatgtctggaagaacacaaaat
gaaggaagaattgtgaactggaagctgattttgcatgggactgctcctcagccggaacac
atgaaacagcctcgtgtgtacacatcttacaacaccgttcagaatgacagaagaggggtg
gagaagatggtgcattctggggaggagcagccaacaccagagaacctgaatgagaatccc
ctggtggcaaaaagccccagcagcagcagtgtggggaatagaagggatgaaatggcagga
ggagccccttcggaggccatgctgcggctcctacaaagtgctttcagcaaaaactcaccc
tcaaagcaatcaccaaagaagtcgccaagtgcaaagctcaacatcccttacgaaaatttc
tacgaagccttggaaaagctgaacaaaccttcccagcttagagactcagaggacagtctg
tataatgactacgttgacgttttctataacacaaaaccttacaagcacagagatgatcgg
ctgctgcaagctctggtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system