KEGG   Trichechus manatus latirostris (Florida manatee): 101353557Help
Entry
101353557         CDS       T05135                                 

Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00590  Arachidonic acid metabolism
tmu01100  Metabolic pathways
tmu04611  Platelet activation
tmu04726  Serotonergic synapse
tmu04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101353557
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101353557
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101353557
  09156 Nervous system
   04726 Serotonergic synapse
    101353557
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101353557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 101353557
NCBI-ProteinID: XP_023586453
UniProt: A0A2Y9R4C7
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MLMRLVLTVRANLVPSPPTYNSAHDYISWESFSNQSYYTRILPSVPQDCPTPMGTKGKKQ
LPDAQFLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDL
GHIYGDNLERQYQLRLFKDGKLKYQVLDGDVYPPSVEEAPVLMHYPQKISPRNQMAVGQE
VFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQ
QLSGYFLQLKFDPELLFGVQFQYSNRIAVEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFN
TSMLADYGVEALVDAFSRQGAGKIGGGRNIDQHVLHVAVEVIKESRELRLQPFNEYRKRF
GMRPYTSFEELTGEKEMAAELEELYGDIDAMEFYPGLLLEKCHPNSIFGESMIEIGAPFS
LKGLLGNAICSPEYWKPSTFGGEIGFNIVKTATLKKLVCLNTKTCPYVSFRVPDPSQADP
PTVERPSTEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgcgtttggtactcacagtgcgtgccaaccttgtccccagccccccaacctac
aactccgcacatgactacatcagctgggagtccttctccaatcagagctactatacccgt
attctgccctctgtgccccaagactgccctacacccatgggaaccaaagggaagaagcag
ttgccagatgcccagttcctggcccgtcgcttcctgctcaggaggaagttcatacctgat
ccccaaggcaccaacctcatgtttgccttttttgcacaacattttacccaccagttcttc
aaaacttctggcaagatgggtcctggcttcactaaggccttgggccatggggtagacctg
ggccacatttatggagacaatctggaacgtcagtatcagctgcggctctttaaggatggg
aaactcaagtaccaggtgctggacggagacgtataccccccatcagtggaagaagcacct
gtgttgatgcactacccacagaagatttcgccacggaaccagatggctgtgggccaggag
gtgtttgggctgcttcctggcctcatgctctatgccacaatctggttgcgtgagcacaac
cgtgtgtgtgacctgctgaaggccgagcaccccacgtgggacgacgagcagctcttccag
acgacccgcctcatcctcataggggagaccatcaagatcgtaattgaggagtatgtgcag
cagttgagtggctacttcctgcagctgaaatttgacccggagctgctatttggcgtccag
ttccagtacagcaaccgcattgctgtggagttcaaccacctctaccactggcacccgctc
atgcctgactccttcaaggtgggctcccaagagtacagctacgagcagttcttgttcaac
acttccatgctagcggactatggggttgaggccctagtggacgccttctctcgtcagggc
gctggcaagatcggtgggggtaggaacatagaccagcacgtcctgcacgtcgccgtggag
gtcatcaaggagtctcgagagctgcggctgcagccctttaatgagtaccgcaagaggttt
ggcatgaggccctacacctctttcgaggagctcacaggagagaaggagatggcggctgag
ttggaagagctatatggtgatatcgatgccatggagttctatccggggctgcttcttgag
aagtgccatccaaattccatctttggggagagtatgatagaaattggggctcccttttcc
ctcaagggcctcctagggaatgccatctgttctccagagtactggaagcccagcacgttt
ggcggtgagataggtttcaacattgtcaagactgccacactgaagaagctggtctgcctc
aacaccaaaacctgtccgtatgtttccttccgtgtgcctgaccccagccaagctgaccca
cctactgtggagcggccatccacagagctctaa

DBGET integrated database retrieval system