KEGG   Trichechus manatus latirostris (Florida manatee): 101353562Help
Entry
101353562         CDS       T05135                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00020  Citrate cycle (TCA cycle)
tmu00190  Oxidative phosphorylation
tmu01100  Metabolic pathways
tmu01200  Carbon metabolism
tmu04714  Thermogenesis
tmu04932  Non-alcoholic fatty liver disease (NAFLD)
tmu05010  Alzheimer disease
tmu05012  Parkinson disease
tmu05016  Huntington disease
Module
tmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101353562
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101353562
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101353562
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101353562
   05012 Parkinson disease
    101353562
   05016 Huntington disease
    101353562
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101353562
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101353562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101353562
NCBI-ProteinID: XP_004377263
UniProt: A0A2Y9DM73
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGVSLRRRFPATTLGAACLQACRGAQTAAAVAPQIKKFAIYRWDPDKAGDKPRMQT
YEIDLNKCGPMVLDALIKIKNEIDATLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTSTCPKGLNPGKAIAEIKKMMVTYQEKKVSA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtggttggagtctccttgaggcgcaggttcccggccacgacccttggcgca
gcctgcctgcaggcctgccgtggggcccagacagctgcagccgtagctccccaaatcaag
aaatttgccatctatcggtgggatccagataaggctggagataaacctcgcatgcagact
tatgaaattgatctgaataaatgtggtcctatggtattggatgctttgatcaagattaag
aatgaaatcgatgctaccttgacctttcgaagatcatgcagagaaggtatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcactcgcaggattgacaccaac
ctcaataaagtctcaaaaatctaccctcttccacatatgtatgtgataaaggatcttgtc
cctgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatcccaggaaggcaagcagcagtacctgcagtccatagaagatcgtgagaaactg
gatgggctttacgagtgcattctctgtgcctgctgcagcaccagctgccctagctactgg
tggaatggagacaagtatttgggacctgcggttcttatgcaggcctatcgctggatgatc
gactccagagacgacttcacagaggagcgcctggccaagctgcaggaccccttctctctg
taccgctgccacaccatcatgaactgcacgagcacctgtcccaagggtctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggtaacctatcaggagaagaaagtctcagct
taa

DBGET integrated database retrieval system