KEGG   Trichechus manatus latirostris (Florida manatee): 101354258
Entry
101354258         CDS       T05135                                 

Definition
(RefSeq) TGF-beta receptor type-2 isoform X4
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04068  FoxO signaling pathway
tmu04144  Endocytosis
tmu04218  Cellular senescence
tmu04350  TGF-beta signaling pathway
tmu04380  Osteoclast differentiation
tmu04390  Hippo signaling pathway
tmu04520  Adherens junction
tmu04659  Th17 cell differentiation
tmu04926  Relaxin signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05142  Chagas disease
tmu05161  Hepatitis B
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05220  Chronic myeloid leukemia
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101354258
   04350 TGF-beta signaling pathway
    101354258
   04390 Hippo signaling pathway
    101354258
   04068 FoxO signaling pathway
    101354258
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101354258
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101354258
  09143 Cell growth and death
   04218 Cellular senescence
    101354258
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101354258
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101354258
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101354258
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101354258
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101354258
   05202 Transcriptional misregulation in cancer
    101354258
  09162 Cancer: specific types
   05210 Colorectal cancer
    101354258
   05212 Pancreatic cancer
    101354258
   05225 Hepatocellular carcinoma
    101354258
   05226 Gastric cancer
    101354258
   05220 Chronic myeloid leukemia
    101354258
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101354258
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101354258
   05161 Hepatitis B
    101354258
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101354258
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101354258
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101354258
Protein kinases [BR:tmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101354258
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101354258
NCBI-ProteinID: XP_004377415
UniProt: A0A2Y9DMJ8
LinkDB
Position
Unknown
AA seq 592 aa
MGRGLLGGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIFYPSCNRTTHPLKPFNDD
MMVTDNNGAFKLRQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPHEVCVAVWRKNDENI
TLETICHDPKLPYHGFVLEDTASSKCIMKEKKTVGETFFMCACSAEECNDHVIFSEEYNT
SSPDLLLVIIQVTGVSLLPPLGVAIAVIITFYCYRVHRQQKLSPSWETSKPRKLMEFSEH
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLHLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcgggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcagaagtcggatgtggaaatggaggcccagaaagat
gaaatcttctacccaagctgtaataggactactcatccactgaaaccttttaacgacgac
atgatggtcacggacaacaacggtgcgttcaagttgcggcaactgtgtaaattttgtgac
gtgagattttccacctgtgacaaccaaaaatcttgtatgagcaactgcagcatcacgtcc
atctgtgagaaaccacacgaagtctgtgtggctgtatggagaaagaatgatgaaaacata
acactagagacaatttgccatgaccccaagctcccctaccatggatttgtcctggaagat
actgcttcttcaaagtgtattatgaaggagaagaaaacggttggtgagaccttctttatg
tgtgcctgtagcgctgaggagtgcaatgaccacgtcatcttctctgaagaatataacacc
agcagccctgacttgttgctagtcatcatccaagtgacaggcgtcagcctcctgccgccg
ctgggggtcgccatagctgtgatcatcaccttctactgctaccgcgttcaccgacagcag
aagctgagcccatcctgggagaccagcaagccaaggaagctcatggagttcagtgagcac
tgtgccatcattctggaagatgaccgctcagacatcagctctacctgcgccaacaacatc
aaccacaacacagagctgctgcccattgagctggacaccctggtaggcaagggccgcttc
gccgaggtctacaaggccaagctgaaacagaacacttcagagcagtttgagaccgtggca
gtcaagatcttcccctatgaggagtatgcctcttggaagacagagaaggacatcttctcc
gacattaacctgaagcatgagaacatactccagttcttgacggccgaggagcggaagaca
gagctggggaagcagtattggctgatcactgccttccacgccaagggtaacctacaggag
tacctcacgaggcatgtcatcagctgggaggacctgcgcaagctaggcagctcccttgcc
cgaggcattgctcacctgcacagtgatcataccccttgtgggaggcccaagatgcccatt
gtacacagggacctcaagagctccaatatccttgtgaagaacgacctgacctgctgtctc
tgtgacttcgggctttcattgcacctggaccctactctgtctgtggatgacctggccaac
agtgggcaagtgggaactgcaagatacatggccccggaagtcctcgaatccaggatgaat
ttggagaatgttgagtccttcaagcagaccgatgtctactcgatggctctggtcctctgg
gaaatgacgtctcgctgtaatgcggtgggagaagtgaaagattacgagcctccgtttggg
tccaaggtgcgggagcatccgtgtgtcgaaagcatgaaggacaatgtgttgcgagatcga
ggacgaccagaaattcctagctcctggctcaaccatcagggcatccagatggtgtgtgag
acgctgaccgagtgctgggaccacgaccccgaggcccgtctcacggcccagtgcgtggca
gagcgcttcagtgagctggagcacctggacagactctcggggaggagctgttccgaggag
aagattccagaagatggttccctgaacactaccaaatag

DBGET integrated database retrieval system